BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30591 (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29492| Best HMM Match : Ribosomal_S3_C (HMM E-Value=1.8e-28) 161 3e-40 SB_1330| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.9) 33 0.15 SB_5097| Best HMM Match : GARS_A (HMM E-Value=0) 30 1.4 SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) 29 3.2 SB_51602| Best HMM Match : Glyco_hydro_38C (HMM E-Value=1.1e-31) 29 3.2 SB_42203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 29 3.2 SB_14482| Best HMM Match : Cornifin (HMM E-Value=3.7) 28 5.6 SB_45126| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_27312| Best HMM Match : Pox_A32 (HMM E-Value=0.012) 28 7.4 SB_10998| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_35876| Best HMM Match : Histone (HMM E-Value=5.1) 27 9.8 SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09) 27 9.8 SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) 27 9.8 SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_42599| Best HMM Match : DUF536 (HMM E-Value=7.2) 27 9.8 SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_20764| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 27 9.8 SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16) 27 9.8 SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) 27 9.8 SB_17103| Best HMM Match : Histone (HMM E-Value=0.65) 27 9.8 SB_16704| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_15200| Best HMM Match : Histone (HMM E-Value=0.22) 27 9.8 SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) 27 9.8 SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) 27 9.8 SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) 27 9.8 SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.8 SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 >SB_29492| Best HMM Match : Ribosomal_S3_C (HMM E-Value=1.8e-28) Length = 240 Score = 161 bits (392), Expect = 3e-40 Identities = 76/81 (93%), Positives = 80/81 (98%) Frame = +3 Query: 255 SVELYAEKVATRGLCAIAQAESLRYKLIGGLAVRRACYGVLRFIMESGARGCEVVVSGKL 434 SVELYAEKVATRGLCAIAQ ESLRYKLIGGLAVRRACYGVLRFIMESGA+GCEVVVSGKL Sbjct: 83 SVELYAEKVATRGLCAIAQCESLRYKLIGGLAVRRACYGVLRFIMESGAKGCEVVVSGKL 142 Query: 435 RGQRAKSMKFVDGLMIHSGDP 497 RGQRAKSMKFVDGLM+H+G+P Sbjct: 143 RGQRAKSMKFVDGLMVHAGEP 163 Score = 144 bits (349), Expect = 5e-35 Identities = 70/77 (90%), Positives = 74/77 (96%) Frame = +1 Query: 22 ISKKRKFVGDGVFKAELNEFLTRELAEDGYSGVEVRVTPIRSEIIIMATRTQSVLGEKGR 201 ISKKRKFV DG+FKAELNEFLTRELAEDGYSGVEVRVTPIR+EIII+ATRTQ+VLGEKGR Sbjct: 5 ISKKRKFVADGLFKAELNEFLTRELAEDGYSGVEVRVTPIRTEIIILATRTQNVLGEKGR 64 Query: 202 RIRELTSVVQKRFNIPE 252 RIRELTSVVQKRF PE Sbjct: 65 RIRELTSVVQKRFGFPE 81 Score = 73.7 bits (173), Expect = 1e-13 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +2 Query: 509 VNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILV 637 V+TA RHV LRQGVLGIKVKIMLPWD GK GPKKP PD + + Sbjct: 168 VDTAVRHVYLRQGVLGIKVKIMLPWDPTGKTGPKKPLPDQVSI 210 >SB_1330| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.9) Length = 482 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +1 Query: 574 VAVGPARQERPEEATTRPHPG 636 VA GPAR PE TRPHPG Sbjct: 107 VAAGPARITSPEPPATRPHPG 127 >SB_5097| Best HMM Match : GARS_A (HMM E-Value=0) Length = 893 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 396 GARGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCND*STLL 521 G G +V+ KL G+ + F DG I + P D TLL Sbjct: 183 GDAGSTIVIEEKLEGEEFSVLAFTDGKTIAAMPPAQDHKTLL 224 >SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 59 SRQNSMSSSLGSWPRTATPAWKCGSLPSARRSLLWPPGH-RVCSERKDAESVSSLP*Y 229 +R+ ++ +L + P T +CG + +AR L+ P H R + V SLP Y Sbjct: 272 TRKMMLTRALSTTPSTTPELRRCGGVLTAREGLIMSPNHPRPYPSDTHCKWVISLPSY 329 >SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) Length = 401 Score = 29.1 bits (62), Expect = 3.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 425 WQAAWSTCQINEVCRWTHDPLW 490 W+ AW+ C + E +T++P W Sbjct: 76 WKQAWTPCSLQETTIYTNNPPW 97 >SB_51602| Best HMM Match : Glyco_hydro_38C (HMM E-Value=1.1e-31) Length = 976 Score = 29.1 bits (62), Expect = 3.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +2 Query: 419 CIWQAAWSTCQINEVCRWTHDPLWRP 496 C W + W + E WTH P RP Sbjct: 185 CRWLSQWKQSEEEESVLWTHSPARRP 210 >SB_42203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = +2 Query: 284 YSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPFHHGIWCPW 406 Y+W L + P + ++ Y R + L C+P + W W Sbjct: 4 YNWWLAWNPALLCLMRQYNRWLAWNPALLCNPRQYNRWLAW 44 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.1 bits (62), Expect = 3.2 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +1 Query: 547 STRNQGQNHVAVGPARQERPEEATTRP 627 +++N + H + PA+QE+PE + +P Sbjct: 162 TSKNTSRTHKIIAPAKQEKPERYSRKP 188 >SB_14482| Best HMM Match : Cornifin (HMM E-Value=3.7) Length = 301 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 586 PARQERPEEATTRPHPG 636 PAR PE TRPHPG Sbjct: 42 PARVTSPEPPATRPHPG 58 >SB_45126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 296 KATSSHLFSIQFYRCSGMLNRFCTTEVSSRIL 201 K + H +I F R M+ R CTT+ S+ ++ Sbjct: 60 KLQNDHQAAIAFKRAKSMVGRSCTTQTSTLVI 91 >SB_27312| Best HMM Match : Pox_A32 (HMM E-Value=0.012) Length = 1115 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 586 PARQERPEEATTRPHPG 636 PAR PE TRPHPG Sbjct: 537 PARITSPEPPATRPHPG 553 >SB_10998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 296 KATSSHLFSIQFYRCSGMLNRFCTTEVSSRIL 201 K + H +I F R M+ R CTT+ S+ ++ Sbjct: 60 KLQNDHQAAIAFKRAKSMVGRSCTTQTSTLVI 91 >SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_35876| Best HMM Match : Histone (HMM E-Value=5.1) Length = 157 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 260 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 158 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 192 >SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 998 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 252 LWNVESLLYYGSELTDSASFLSEHTLCPGGHNNDLRADGSDPH 124 LWN++ + + F + H+ C GG N D A GS+ H Sbjct: 186 LWNIKDRVLERKYQGVTQGFYTIHS-CFGGVNQDFLASGSEDH 227 >SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09) Length = 110 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 205 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 103 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 137 >SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 131 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 29 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 63 >SB_42599| Best HMM Match : DUF536 (HMM E-Value=7.2) Length = 120 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/63 (28%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +1 Query: 67 ELNEFLTRELAE-DGYSGVEVRVTPIRSEIIIMATRTQSVLGEKGRRIRELTSVVQKRFN 243 E+ E + + +AE +G SG EV+ ++ + ++ +TQ E ++ +EL + +KR N Sbjct: 20 EVIEVVNKLIAEGEGESGNEVKENKVKKKPSVIK-QTQ----EDEKKTKELEELKEKRIN 74 Query: 244 IPE 252 +P+ Sbjct: 75 LPQ 77 >SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 258 QMLWNVESLLYYGSELTDSASFLSEHTLCPGGHNN 154 + L NV+SLL GS++ S + + H + P G N Sbjct: 214 ECLNNVKSLLTTGSDVVTSTTVMQRHLMPPPGKPN 248 >SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_20764| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 68 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16) Length = 117 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_17103| Best HMM Match : Histone (HMM E-Value=0.65) Length = 97 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_16704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 988 Score = 27.5 bits (58), Expect = 9.8 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -1 Query: 558 IPSTPCLRSTCLVAVLTNHCKGLQSGS*VHLQTSLIWHVDHAACQIQQLHNHGHQI 391 I P L C V V T HCKG++ G Q +W Q + +H Q+ Sbjct: 553 IKFNPELYGACNVDVET-HCKGIKEGQAQVAQCVSVWSHSPQVVQCVSVWSHSPQV 607 >SB_15200| Best HMM Match : Histone (HMM E-Value=0.22) Length = 97 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) Length = 162 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) Length = 370 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 278 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 382 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,602,292 Number of Sequences: 59808 Number of extensions: 462140 Number of successful extensions: 1432 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 1304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1428 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -