BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30586 (763 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 23 2.0 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 6.1 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 8.1 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 23.4 bits (48), Expect = 2.0 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = -2 Query: 747 WT*HTIRITFL*HYRLTTPHQRRPSLSTPAPSHTNIIEACFRNLRF 610 WT I I L HY+ TT ++ S ++E CF L + Sbjct: 123 WT--KIEINLLKHYQSTTDLHKKIRYSAFGMIFVALLEHCFSMLNY 166 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 415 SIHRRFKDQN*SSTELSFYLNSC 483 ++H++ QN S ELS +N C Sbjct: 312 NMHQQHHQQNMSHEELSAMVNRC 334 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.4 bits (43), Expect = 8.1 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = +1 Query: 175 CKAGELFDELG 207 CK G++FD++G Sbjct: 209 CKLGQVFDDVG 219 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,231 Number of Sequences: 336 Number of extensions: 3507 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -