BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30586 (763 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 23 3.1 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 23 3.1 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 9.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.4 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 456 CRRSVLIFEPAVDGL 412 C RS+++F P V GL Sbjct: 335 CLRSIILFNPEVRGL 349 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 456 CRRSVLIFEPAVDGL 412 C RS+++F P V GL Sbjct: 335 CLRSIILFNPEVRGL 349 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.4 bits (43), Expect = 9.4 Identities = 12/50 (24%), Positives = 20/50 (40%) Frame = +1 Query: 193 FDELGGRSRVLRFTTSLPAGRFDYSKLTPERRRHNFTLAFKIADEKAGIY 342 F+ GR R+ T F Y++ RRR A + + + I+ Sbjct: 268 FERKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIW 317 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 325 EKAGIYPLLDVEDMV 369 EKA + PLL +ED+V Sbjct: 711 EKALLKPLLSLEDLV 725 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,548 Number of Sequences: 438 Number of extensions: 4166 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -