BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30584 (765 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 25 0.88 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 0.88 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 0.88 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 23 2.0 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 6.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 6.2 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 24.6 bits (51), Expect = 0.88 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 630 LPRPFMILGDFNSHHTSW 577 +P P M L DF SH +W Sbjct: 202 VPPPLMFLQDFLSHQHAW 219 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.6 bits (51), Expect = 0.88 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 630 LPRPFMILGDFNSHHTSW 577 +P P M L DF SH +W Sbjct: 435 VPPPLMFLQDFLSHQHAW 452 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.6 bits (51), Expect = 0.88 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 630 LPRPFMILGDFNSHHTSW 577 +P P M L DF SH +W Sbjct: 435 VPPPLMFLQDFLSHQHAW 452 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 23.4 bits (48), Expect = 2.0 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 450 SMALITSPGFV-RRVGEPEFKCTGYTCLRCLIIHNHNY*ILNYP 578 S+ L S F+ R++GE C G + I H H Y + + P Sbjct: 72 SLRLYPSVHFISRKLGEDFVTCNGLKLPKSTITHLHIYDLHHNP 115 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 6.2 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 42 PPPHPH 25 PPPHPH Sbjct: 737 PPPHPH 742 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 6.2 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 42 PPPHPH 25 PPPHPH Sbjct: 629 PPPHPH 634 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,590 Number of Sequences: 336 Number of extensions: 3855 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -