BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30584 (765 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 25 1.0 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 24 1.3 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 22 5.4 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 22 5.4 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 7.2 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 9.5 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 9.5 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 9.5 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 239 VLPTARLPSIRPVIMSFSNSCLEDRMMCPKKLIT 138 VL P + ++FS SCL + ++CP +T Sbjct: 416 VLTIEEKPFVYVREIAFSESCLPEEILCPHFNVT 449 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 24.2 bits (50), Expect = 1.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 312 HGLHGLHG 289 HGLHGLHG Sbjct: 135 HGLHGLHG 142 Score = 24.2 bits (50), Expect = 1.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 312 HGLHGLHG 289 HGLHGLHG Sbjct: 138 HGLHGLHG 145 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 306 LHGLHGTNYHRVLLLLDRPS 247 LH + GT+Y +++ L PS Sbjct: 286 LHNIEGTHYVKIVYYLGIPS 305 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 306 LHGLHGTNYHRVLLLLDRPS 247 LH + GT+Y +++ L PS Sbjct: 301 LHNIEGTHYVKIVYYLGIPS 320 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.8 bits (44), Expect = 7.2 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -1 Query: 249 SGWCSAHGALAFYSTRNYELL*FMSGRPHDVSEEAHN 139 +GW G FY + Y+ ++ R DV EE N Sbjct: 178 TGWTFHEGRKQFYFHQFYKQQPDLNYRNSDVREEMKN 214 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/26 (38%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = -1 Query: 84 GLVCS-HGSPRYSQHPPPHPHFKGID 10 G C HGSP + PP P + +D Sbjct: 439 GSACRIHGSPATTAAPPQLPTEESVD 464 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = -1 Query: 372 YRSLTTEDRDHMRCTSNAPDHGLHGLHG 289 Y+ +T + H++ H LHG+ G Sbjct: 312 YKYITPLIQKHLKIHDTCGVHNLHGMPG 339 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 471 PGFVRRVGEPEFKC 512 PG VRR +P F+C Sbjct: 410 PGRVRRRYQPAFRC 423 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,927 Number of Sequences: 438 Number of extensions: 4888 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -