BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30583 (765 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB17E12.05 |rpl3703|rpl37|60S ribosomal protein L37|Schizosac... 85 1e-17 SPCC1223.05c |rpl3702|rpl37-2, rpl37|60S ribosomal protein L37|S... 85 1e-17 >SPAPB17E12.05 |rpl3703|rpl37|60S ribosomal protein L37|Schizosaccharomyces pombe|chr 1|||Manual Length = 89 Score = 84.6 bits (200), Expect = 1e-17 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +3 Query: 9 MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRS 146 MTKGT SFG R NK+HT+CRRCG+ S+HIQKS CA CGYPAAK RS Sbjct: 1 MTKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRS 46 >SPCC1223.05c |rpl3702|rpl37-2, rpl37|60S ribosomal protein L37|Schizosaccharomyces pombe|chr 3|||Manual Length = 91 Score = 84.6 bits (200), Expect = 1e-17 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +3 Query: 9 MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRS 146 MTKGT SFG R NK+HT+CRRCG+ S+HIQKS CA CGYPAAK RS Sbjct: 1 MTKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRS 46 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,869,080 Number of Sequences: 5004 Number of extensions: 55978 Number of successful extensions: 110 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -