BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30583 (765 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g52300.1 68414.m05901 60S ribosomal protein L37 (RPL37B) simi... 83 1e-16 At3g16080.1 68416.m02032 60S ribosomal protein L37 (RPL37C) simi... 81 1e-15 At1g15250.1 68414.m01825 60S ribosomal protein L37 (RPL37A) almo... 81 1e-15 At2g05330.1 68415.m00561 speckle-type POZ protein-related contai... 29 4.5 >At1g52300.1 68414.m05901 60S ribosomal protein L37 (RPL37B) similar to SP:Q43292 from [Arabidopsis thaliana] Length = 95 Score = 83.4 bits (197), Expect = 1e-16 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +3 Query: 9 MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRS 146 MTKGT SFGKRRNK+HTLC RCGR S+HIQKS+C+ C YPAA+ R+ Sbjct: 1 MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRT 46 >At3g16080.1 68416.m02032 60S ribosomal protein L37 (RPL37C) similar to ribosomal protein L37 GB:BAA04888 from [Homo sapiens] Length = 95 Score = 80.6 bits (190), Expect = 1e-15 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +3 Query: 9 MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRS 146 M KGT SFGKRRNK+HTLC RCGR S+HIQKS+C+ C YPAA+ R+ Sbjct: 1 MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRT 46 >At1g15250.1 68414.m01825 60S ribosomal protein L37 (RPL37A) almost identical to GB:Q43292 Length = 95 Score = 80.6 bits (190), Expect = 1e-15 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +3 Query: 9 MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRS 146 M KGT SFGKRRNK+HTLC RCGR S+HIQKS+C+ C YPAA+ R+ Sbjct: 1 MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRT 46 >At2g05330.1 68415.m00561 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain Length = 215 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +3 Query: 57 TLCRRCGRSSYHIQK-SKCAQCGY 125 T C RCG +YH Q + C CG+ Sbjct: 186 TSCSRCGLITYHNQTGTSCCSCGF 209 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,173,304 Number of Sequences: 28952 Number of extensions: 263854 Number of successful extensions: 478 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -