BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30582 (758 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 25 0.58 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 24 1.3 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 7.2 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 25.4 bits (53), Expect = 0.58 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 353 LYWLFRWSQRWGF 391 L WL W ++WGF Sbjct: 283 LKWLVNWGEQWGF 295 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 24.2 bits (50), Expect = 1.3 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +2 Query: 275 LASTRSTP*ICACFECCKIREGI 343 ++ST S C+C +C +IRE + Sbjct: 316 ISSTPSQASSCSCLDCDEIRESL 338 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 7.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 270 PSLHPLEAPREYVRALNAVKLERVFAKPFI 359 P P A + +RALN ++ RVF PF+ Sbjct: 384 PPPGPTPAQKARMRALNIDRVSRVFF-PFL 412 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,112 Number of Sequences: 438 Number of extensions: 4029 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -