BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30582 (758 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28450.1 68417.m04071 transducin family protein / WD-40 repea... 105 4e-23 At3g49660.1 68416.m05427 transducin family protein / WD-40 repea... 41 8e-04 At4g29860.1 68417.m04250 transducin family protein / WD-40 repea... 41 0.001 At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p... 40 0.001 At1g27840.1 68414.m03412 transducin family protein / WD-40 repea... 40 0.001 At1g19750.1 68414.m02469 transducin family protein / WD-40 repea... 40 0.001 At5g43930.1 68418.m05374 transducin family protein / WD-40 repea... 40 0.002 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 40 0.002 At3g15980.3 68416.m02022 coatomer protein complex, subunit beta ... 39 0.004 At3g15980.2 68416.m02021 coatomer protein complex, subunit beta ... 39 0.004 At3g15980.1 68416.m02020 coatomer protein complex, subunit beta ... 39 0.004 At2g34260.2 68415.m04192 transducin family protein / WD-40 repea... 38 0.005 At2g34260.1 68415.m04191 transducin family protein / WD-40 repea... 38 0.005 At3g18130.1 68416.m02305 guanine nucleotide-binding family prote... 38 0.007 At1g48630.1 68414.m05440 guanine nucleotide-binding family prote... 38 0.007 At1g10580.1 68414.m01192 transducin family protein / WD-40 repea... 38 0.007 At1g03110.1 68414.m00288 transducin family protein / WD-40 repea... 38 0.007 At1g79990.1 68414.m09356 coatomer protein complex, subunit beta ... 38 0.010 At3g18950.1 68416.m02405 transducin family protein / WD-40 repea... 37 0.013 At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pf... 37 0.013 At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pf... 37 0.013 At1g52360.1 68414.m05909 coatomer protein complex, subunit beta ... 37 0.013 At1g04140.2 68414.m00404 transducin family protein / WD-40 repea... 37 0.013 At1g04140.1 68414.m00403 transducin family protein / WD-40 repea... 37 0.013 At4g29830.1 68417.m04246 transducin family protein / WD-40 repea... 37 0.017 At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dep... 37 0.017 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 36 0.022 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 36 0.022 At3g51930.1 68416.m05696 transducin family protein / WD-40 repea... 36 0.022 At3g27640.1 68416.m03452 transducin family protein / WD-40 repea... 36 0.022 At2g22040.1 68415.m02617 transducin family protein / WD-40 repea... 36 0.022 At5g16750.1 68418.m01961 transducin family protein / WD-40 repea... 36 0.029 At5g08390.1 68418.m00988 transducin family protein / WD-40 repea... 36 0.029 At1g73720.1 68414.m08536 transducin family protein / WD-40 repea... 36 0.029 At1g49450.1 68414.m05543 transducin family protein / WD-40 repea... 36 0.029 At5g56130.1 68418.m07002 transducin family protein / WD-40 repea... 35 0.051 At5g25150.1 68418.m02981 transducin family protein / WD-40 repea... 35 0.051 At4g02730.1 68417.m00372 transducin family protein / WD-40 repea... 35 0.051 At5g08560.1 68418.m01018 transducin family protein / WD-40 repea... 34 0.089 At3g05090.2 68416.m00553 transducin family protein / WD-40 repea... 34 0.089 At3g05090.1 68416.m00552 transducin family protein / WD-40 repea... 34 0.089 At4g34380.1 68417.m04884 transducin family protein / WD-40 repea... 34 0.12 At2g26490.1 68415.m03178 transducin family protein / WD-40 repea... 34 0.12 At1g62020.1 68414.m06995 coatomer protein complex, subunit alpha... 34 0.12 At1g47610.1 68414.m05288 transducin family protein / WD-40 repea... 33 0.16 At4g15900.1 68417.m02416 PP1/PP2A phosphatases pleiotropic regul... 33 0.21 At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochro... 33 0.21 At2g47410.1 68415.m05917 transducin family protein / WD-40 repea... 33 0.21 At1g52730.2 68414.m05959 transducin family protein / WD-40 repea... 33 0.21 At1g52730.1 68414.m05958 transducin family protein / WD-40 repea... 33 0.21 At3g16650.1 68416.m02128 PP1/PP2A phosphatases pleiotropic regul... 33 0.27 At2g21390.1 68415.m02546 coatomer protein complex, subunit alpha... 33 0.27 At2g19430.1 68415.m02267 transducin family protein / WD-40 repea... 33 0.27 At4g32990.1 68417.m04692 transducin family protein / WD-40 repea... 32 0.48 At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica... 32 0.48 At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica... 32 0.48 At2g47990.1 68415.m06006 transducin family protein / WD-40 repea... 32 0.48 At3g50390.1 68416.m05512 transducin family protein / WD-40 repea... 31 0.63 At3g18060.1 68416.m02297 transducin family protein / WD-40 repea... 31 0.63 At2g30050.1 68415.m03654 transducin family protein / WD-40 repea... 31 0.63 At2g19540.1 68415.m02283 transducin family protein / WD-40 repea... 31 0.63 At1g71840.1 68414.m08302 transducin family protein / WD-40 repea... 31 0.63 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 31 0.83 At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pf... 31 0.83 At5g11240.1 68418.m01313 transducin family protein / WD-40 repea... 31 0.83 At3g21540.1 68416.m02717 transducin family protein / WD-40 repea... 31 0.83 At2g20330.1 68415.m02374 transducin family protein / WD-40 repea... 31 0.83 At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 pro... 31 1.1 At2g46280.2 68415.m05756 eukaryotic translation initiation facto... 31 1.1 At2g46280.1 68415.m05755 eukaryotic translation initiation facto... 31 1.1 At1g24530.1 68414.m03088 transducin family protein / WD-40 repea... 31 1.1 At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 ... 30 1.5 At5g21040.1 68418.m02503 F-box family protein / WD-40 repeat fam... 30 1.5 At4g35370.1 68417.m05025 transducin family protein / WD-40 repea... 30 1.5 At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) co... 30 1.5 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 30 1.5 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 30 1.5 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 30 1.5 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 30 1.5 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 30 1.5 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 30 1.5 At2g05720.1 68415.m00613 transducin family protein / WD-40 repea... 30 1.5 At1g24130.1 68414.m03044 transducin family protein / WD-40 repea... 30 1.5 At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pf... 30 1.9 At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pf... 30 1.9 At4g01860.2 68417.m00244 transducin family protein / WD-40 repea... 30 1.9 At4g01860.1 68417.m00243 transducin family protein / WD-40 repea... 30 1.9 At4g00090.1 68417.m00009 transducin family protein / WD-40 repea... 30 1.9 At3g44530.1 68416.m04786 transducin family protein / WD-40 repea... 30 1.9 At2g40360.1 68415.m04977 transducin family protein / WD-40 repea... 30 1.9 At1g21650.1 68414.m02710 preprotein translocase secA family prot... 30 1.9 At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pf... 29 2.5 At5g48800.1 68418.m06038 phototropic-responsive NPH3 family prot... 29 2.5 At5g15550.2 68418.m01821 transducin family protein / WD-40 repea... 29 2.5 At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ... 29 2.5 At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 pro... 29 2.5 At3g01340.1 68416.m00051 protein transport protein SEC13 family ... 29 2.5 At2g46290.1 68415.m05758 eukaryotic translation initiation facto... 29 2.5 At2g43770.1 68415.m05441 transducin family protein / WD-40 repea... 29 2.5 At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pf... 29 2.5 At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless... 29 3.4 At5g50120.1 68418.m06207 transducin family protein / WD-40 repea... 29 3.4 At5g49430.1 68418.m06116 transducin family protein / WD-40 repea... 29 3.4 At4g18905.1 68417.m02787 transducin family protein / WD-40 repea... 29 3.4 At4g18900.1 68417.m02786 transducin family protein / WD-40 repea... 29 3.4 At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10... 29 3.4 At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogene... 29 3.4 At5g64730.1 68418.m08140 transducin family protein / WD-40 repea... 29 4.4 At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 ... 29 4.4 At3g15610.1 68416.m01980 transducin family protein / WD-40 repea... 29 4.4 At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf... 29 4.4 At2g17470.1 68415.m02017 expressed protein contains Pfam profile... 29 4.4 At2g01330.1 68415.m00050 transducin family protein / WD-40 repea... 29 4.4 At1g18830.1 68414.m02345 transducin family protein / WD-40 repea... 29 4.4 At5g40880.1 68418.m04964 WD-40 repeat family protein / zfwd3 pro... 28 5.9 At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pf... 28 5.9 At5g15550.1 68418.m01820 transducin family protein / WD-40 repea... 28 5.9 At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 ... 28 5.9 At4g03020.1 68417.m00410 transducin family protein / WD-40 repea... 28 5.9 At2g46280.3 68415.m05757 eukaryotic translation initiation facto... 28 5.9 At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 ... 28 5.9 At2g16780.1 68415.m01924 WD-40 repeat protein (MSI2) contains 5 ... 28 5.9 At1g49540.1 68414.m05553 transducin family protein / WD-40 repea... 28 5.9 At5g63010.1 68418.m07905 WD-40 repeat family protein contains 4 ... 28 7.7 At5g50230.1 68418.m06221 transducin family protein / WD-40 repea... 28 7.7 At4g35140.1 68417.m04996 transducin family protein / WD-40 repea... 28 7.7 At4g02290.1 68417.m00310 glycosyl hydrolase family 9 protein sim... 28 7.7 At3g26480.1 68416.m03301 transducin family protein / WD-40 repea... 28 7.7 At3g20740.1 68416.m02624 fertilization-independent endosperm pro... 28 7.7 At3g13300.2 68416.m01675 transducin family protein / WD-40 repea... 28 7.7 At3g13300.1 68416.m01674 transducin family protein / WD-40 repea... 28 7.7 At3g13290.1 68416.m01673 transducin family protein / WD-40 repea... 28 7.7 At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic c... 28 7.7 >At4g28450.1 68417.m04071 transducin family protein / WD-40 repeat family protein SOF1 (involved in rRNA processing) protein-yeast Length = 442 Score = 105 bits (251), Expect = 4e-23 Identities = 43/83 (51%), Positives = 61/83 (73%) Frame = +3 Query: 261 NYDPSLHPLEAPREYVRALNAVKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGA 440 N+DPSL P+E EY RAL A KLE++FA+PF+G +DGHRDGVS MAK+P+ L + S + Sbjct: 17 NFDPSLRPMEKAVEYQRALTAAKLEKIFARPFVGAMDGHRDGVSCMAKNPNYLKGIFSAS 76 Query: 441 FDGEVRIWDLTVRKCTRNFVAHE 509 DG++R+WD++ R+ F H+ Sbjct: 77 MDGDIRLWDISSRRTVCQFPGHQ 99 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 8/88 (9%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDE--------EPTNTLLSMSVVSGI 664 G VR L + DG +S G D T++ W + ED EP+ T + + + Sbjct: 100 GAVRGLTASTDGNVLVSCGTDCTVRLWNVPRPSLEDSSISSENFIEPSATYVWKNAFWAV 159 Query: 665 THHRNKPIFATCGEQCQLWENTRNEPIK 748 H +FAT G Q +W + R++P++ Sbjct: 160 DHQFEGDLFATAGAQLDIWNHNRSQPVQ 187 >At3g49660.1 68416.m05427 transducin family protein / WD-40 repeat family protein beta-transducin, Schizosaccharomyces pombe, EMBL:CAA17803 Length = 317 Score = 41.1 bits (92), Expect = 8e-04 Identities = 24/63 (38%), Positives = 33/63 (52%) Frame = +3 Query: 324 VKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVA 503 +KL V I L GH + + +P Q ++ SG+FD VRIWD+T KC + A Sbjct: 95 LKLWDVETGSLIKTLIGHTNYAFCVNFNP-QSNMIVSGSFDETVRIWDVTTGKCLKVLPA 153 Query: 504 HED 512 H D Sbjct: 154 HSD 156 Score = 37.1 bits (82), Expect = 0.013 Identities = 18/49 (36%), Positives = 30/49 (61%) Frame = +3 Query: 318 NAVKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIW 464 N V + + +K + L+GH + V +A HP++ ++ASG+ D VRIW Sbjct: 265 NCVHMWELNSKKLLQKLEGHTETVMNVACHPTE-NLIASGSLDKTVRIW 312 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 524 LCYNPDGKHFMSVGDDKTIKTWKAE 598 + ++ D + +S DDKT+K W E Sbjct: 77 VAFSSDARFIVSASDDKTLKLWDVE 101 >At4g29860.1 68417.m04250 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); WDVCF variant 1 (gi:12006981) [Mus musculus] Length = 386 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/50 (38%), Positives = 30/50 (60%) Frame = +3 Query: 357 IGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAH 506 + L GHR V ++ HPS+ ++L +G+ DGE+RIWD + + AH Sbjct: 10 VAVLRGHRHSVMDVSFHPSK-SLLFTGSADGELRIWDTIQHRAVSSAWAH 58 >At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80 subunit, putative contains 5 WD-40 repeats (PF00400); similar to katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 1180 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/64 (31%), Positives = 30/64 (46%) Frame = +3 Query: 324 VKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVA 503 +KL V + GHR S + HP LASG+ D ++IWD+ + C + + Sbjct: 82 IKLWDVEEAKMVRAFTGHRSNCSAVEFHPFG-EFLASGSSDANLKIWDIRKKGCIQTYKG 140 Query: 504 HEDG 515 H G Sbjct: 141 HSRG 144 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +3 Query: 360 GCLD---GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHE 509 GC+ GH G+ST+ P V+ SG D V++WDLT K F HE Sbjct: 133 GCIQTYKGHSRGISTIRFTPDGRWVV-SGGLDNVVKVWDLTAGKLLHEFKFHE 184 >At1g27840.1 68414.m03412 transducin family protein / WD-40 repeat family protein contains similarity to cockayne syndrome complementation group A protein GB:U28413 GI:975301 from [Homo sapiens]; confirmed by cDNA gi:1598289 Length = 450 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +3 Query: 324 VKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 V+L + + F L GHRDGV ++ S VL +G DG +R WD+ C R Sbjct: 172 VRLCDIASGAFSHTLSGHRDGVMSVEWSTSSEWVLYTGGCDGAIRFWDIRRAGCFR 227 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/43 (23%), Positives = 23/43 (53%) Frame = +3 Query: 369 DGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNF 497 +GH+ +S+ +P + +G+FD +++WD + +F Sbjct: 100 NGHKYAISSAIWYPIDTGLFITGSFDHYLKVWDTNTAQAVVDF 142 >At1g19750.1 68414.m02469 transducin family protein / WD-40 repeat family protein similar to Cockayne syndrome complementaion group A proteins (GI:18077663)[Mus musculus] and (SP:Q13216)[Homo sapiens]; confirmed by full-length cDNA GI:15982896 Length = 450 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +3 Query: 324 VKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 V+L + + F L GHRDGV ++ S VL +G DG +R WD+ C R Sbjct: 172 VRLCDIASGAFSHTLSGHRDGVMSVEWSTSSEWVLYTGGCDGAIRFWDIRRAGCFR 227 Score = 31.1 bits (67), Expect = 0.83 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +3 Query: 369 DGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNF 497 +GH+ +S+ +P + +G+FD V++WD + +F Sbjct: 100 NGHKYAISSAIWYPIDTGMFITGSFDHYVKVWDTNTSQVVVDF 142 >At5g43930.1 68418.m05374 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to WD-repeat protein 5 (SP:Q9UGP9) [Homo sapiens] Length = 726 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRN 494 L GHR + HP ++ASG+ D EVR+W+ T +C R+ Sbjct: 144 LTGHRRTPWVVRFHPHHSEIVASGSLDLEVRLWNTTTSECIRS 186 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +3 Query: 360 GCLD---GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHE 509 GC+ GH G+ST+ P V+ SG D V++WDLT K F HE Sbjct: 82 GCIQTYKGHTRGISTIEFSPDGRWVV-SGGLDNVVKVWDLTAGKLLHEFKCHE 133 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/64 (29%), Positives = 29/64 (45%) Frame = +3 Query: 324 VKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVA 503 +KL + + GHR S + HP LASG+ D +R+WD + C + + Sbjct: 31 IKLWDLEESKMVRAFTGHRSNCSAVEFHPFG-EFLASGSSDTNLRVWDTRKKGCIQTYKG 89 Query: 504 HEDG 515 H G Sbjct: 90 HTRG 93 >At3g15980.3 68416.m02022 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +3 Query: 348 KPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 K + LDGH VS + HP +L ++ +G+ DG VRIW T Sbjct: 219 KSCVQTLDGHTHNVSAVCFHP-ELPIIITGSEDGTVRIWHAT 259 >At3g15980.2 68416.m02021 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +3 Query: 348 KPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 K + LDGH VS + HP +L ++ +G+ DG VRIW T Sbjct: 219 KSCVQTLDGHTHNVSAVCFHP-ELPIIITGSEDGTVRIWHAT 259 >At3g15980.1 68416.m02020 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 909 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +3 Query: 348 KPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 K + LDGH VS + HP +L ++ +G+ DG VRIW T Sbjct: 219 KSCVQTLDGHTHNVSAVCFHP-ELPIIITGSEDGTVRIWHAT 259 >At2g34260.2 68415.m04192 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina} Length = 296 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = +3 Query: 369 DGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 + H D V+T+ +ASG G V+IWD R C+ F AHED Sbjct: 34 NAHEDAVNTLINVTE--TTIASGDDKGCVKIWDTRQRSCSHEFNAHED 79 >At2g34260.1 68415.m04191 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina} Length = 353 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = +3 Query: 369 DGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 + H D V+T+ +ASG G V+IWD R C+ F AHED Sbjct: 91 NAHEDAVNTLINVTE--TTIASGDDKGCVKIWDTRQRSCSHEFNAHED 136 >At3g18130.1 68416.m02305 guanine nucleotide-binding family protein / activated protein kinase C receptor (RACK1) identical to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 326 Score = 37.9 bits (84), Expect = 0.007 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +3 Query: 432 SGAFDGEVRIWDLTVRKCTRNFVAH 506 SG++DGE+R+WDL + TR FV H Sbjct: 80 SGSWDGELRLWDLATGETTRRFVGH 104 Score = 32.3 bits (70), Expect = 0.36 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 369 DGHRDGVSTMAKHPSQLA-VLASGAFDGEVRIWDLTVRKCTRNFVAH 506 DGH++ VS + P+ L + S ++D V++W+L K + V H Sbjct: 146 DGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNSLVGH 192 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRK 482 L GH ++T+A P ++ ASG DG + +WDL K Sbjct: 189 LVGHSGYLNTVAVSPDG-SLCASGGKDGVILLWDLAEGK 226 >At1g48630.1 68414.m05440 guanine nucleotide-binding family protein / activated protein kinase C receptor, putative / RACK, putative contains 7 WD-40 repeats (PF00400); very similar to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; similar to WD-40 repeat auxin-dependent protein ARCA (SP:O24456) [Arabidopsis thaliana]; Length = 326 Score = 37.9 bits (84), Expect = 0.007 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +3 Query: 432 SGAFDGEVRIWDLTVRKCTRNFVAH 506 SG++DGE+R+WDL + TR FV H Sbjct: 80 SGSWDGELRLWDLATGESTRRFVGH 104 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRK 482 L GH ++T+A P ++ ASG DG + +WDL K Sbjct: 189 LAGHSGYLNTVAVSPDG-SLCASGGKDGVILLWDLAEGK 226 >At1g10580.1 68414.m01192 transducin family protein / WD-40 repeat family protein similar to splicing factor hPRP17 (gi|3283220); contains 7 WD-40 repeats (PF00400);similar to ESTs emb|F15435 and dbj|AUO62661 Length = 573 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 348 KPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL-TVRKCTRNFVAH 506 K + GH GVS + P Q +L S D +V+IWD+ KC R ++ H Sbjct: 272 KRLVHTWSGHTKGVSAIRFFPKQGHLLLSAGMDCKVKIWDVYNSGKCMRTYMGH 325 Score = 34.7 bits (76), Expect = 0.067 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAE 598 VR +C++ DG F++ G DK IK W E Sbjct: 329 VRDICFSNDGSKFLTAGYDKNIKYWDTE 356 >At1g03110.1 68414.m00288 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to WD-repeat domain 4 protein (GI:9955698) [Mus musculus] Length = 427 Score = 37.9 bits (84), Expect = 0.007 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEA 601 +RA+ Y+ GK F+S GDDK +K W A++ Sbjct: 66 IRAIRYSTSGKLFVSAGDDKLVKIWSADS 94 >At1g79990.1 68414.m09356 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens]; similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus] Length = 920 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +3 Query: 348 KPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 K + L+GH VS ++ HP +L ++ +G+ DG VRIW T Sbjct: 219 KSCVQTLEGHTHNVSAVSFHP-ELPIIITGSEDGTVRIWHAT 259 >At3g18950.1 68416.m02405 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein GI:2739374 from [Arabidopsis thaliana]; no characterized homologs Length = 473 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 H D VS ++ + +L +L SG++D +++W L+ KC + AH+D Sbjct: 248 HYDAVSCLSLN-EELGLLYSGSWDKTLKVWRLSDSKCLESIQAHDD 292 >At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 37.1 bits (82), Expect = 0.013 Identities = 21/65 (32%), Positives = 36/65 (55%) Frame = +2 Query: 488 KKFCCS*GWVRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEPTNTLLSMSVVSGIT 667 ++F G + A+ ++PDGK+ S G+D ++ W ++TE EE T+T V SG+ Sbjct: 212 QEFSAHDGSILAMKFSPDGKYIASAGEDCVVRVW---SITE--EERTDTYEVAEVDSGVY 266 Query: 668 HHRNK 682 N+ Sbjct: 267 FGMNQ 271 Score = 32.3 bits (70), Expect = 0.36 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 H + V+ +A +P SG+ DG+VRIWD+T Sbjct: 361 HNNFVTCVAFNPVDDNYFISGSIDGKVRIWDVT 393 >At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 37.1 bits (82), Expect = 0.013 Identities = 21/65 (32%), Positives = 36/65 (55%) Frame = +2 Query: 488 KKFCCS*GWVRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEPTNTLLSMSVVSGIT 667 ++F G + A+ ++PDGK+ S G+D ++ W ++TE EE T+T V SG+ Sbjct: 212 QEFSAHDGSILAMKFSPDGKYIASAGEDCVVRVW---SITE--EERTDTYEVAEVDSGVY 266 Query: 668 HHRNK 682 N+ Sbjct: 267 FGMNQ 271 Score = 32.3 bits (70), Expect = 0.36 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 H + V+ +A +P SG+ DG+VRIWD+T Sbjct: 361 HNNFVTCVAFNPVDDNYFISGSIDGKVRIWDVT 393 >At1g52360.1 68414.m05909 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to (SP:O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus]; similar to GI:298096 from [Homo sapiens] Length = 926 Score = 37.1 bits (82), Expect = 0.013 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +3 Query: 348 KPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 K + L+GH VS + HP +L ++ +G+ DG VRIW T Sbjct: 219 KSCVQTLEGHTHNVSAVCFHP-ELPIIITGSEDGTVRIWHAT 259 >At1g04140.2 68414.m00404 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 793 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 L GHR + HP ++ASG+ D EVR+W+ +C R Sbjct: 141 LTGHRRTPWVVRFHPRHSEIVASGSLDHEVRLWNAKTGECIR 182 >At1g04140.1 68414.m00403 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 790 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 L GHR + HP ++ASG+ D EVR+W+ +C R Sbjct: 141 LTGHRRTPWVVRFHPRHSEIVASGSLDHEVRLWNAKTGECIR 182 >At4g29830.1 68417.m04246 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); G protein beta subunit-like protein, Schistosoma mansoni, gb:U30261 Length = 321 Score = 36.7 bits (81), Expect = 0.017 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = +3 Query: 324 VKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVA 503 V + K +G + GH V ++ P A+ A+G+ D VR+WDL +R + Sbjct: 225 VNMHDAEGKTLLGSMSGHTSWVLSVDASPDGGAI-ATGSSDRTVRLWDLKMRAAIQTMSN 283 Query: 504 HED 512 H D Sbjct: 284 HND 286 Score = 31.9 bits (69), Expect = 0.48 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = +3 Query: 324 VKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 VKL R + GH GV+ +A HPS + + AS + D VR++D+ Sbjct: 42 VKLWRPDELDLVRTNTGHSLGVAALAAHPSGI-IAASSSIDSFVRVFDV 89 >At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dependent protein (ARCA) / guanine nucleotide-binding protein beta subunit, putative identical to SP|O24456 Guanine nucleotide-binding protein beta subunit-like protein (WD-40 repeat auxin-dependent protein ARCA) {Arabidopsis thaliana}; contains 7 WD-40 repeats (PF00400) Length = 327 Score = 36.7 bits (81), Expect = 0.017 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +3 Query: 432 SGAFDGEVRIWDLTVRKCTRNFVAH 506 SG++DGE+R+WDL TR FV H Sbjct: 80 SGSWDGELRLWDLAAGVSTRRFVGH 104 Score = 31.5 bits (68), Expect = 0.63 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRK 482 L GH VST+A P ++ ASG DG V +WDL K Sbjct: 190 LAGHTGYVSTVAVSPDG-SLCASGGKDGVVLLWDLAEGK 227 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 36.3 bits (80), Expect = 0.022 Identities = 19/68 (27%), Positives = 30/68 (44%) Frame = +3 Query: 312 ALNAVKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 A +KL + + L GHR ++ HP ASG+ D ++IWD+ + C Sbjct: 79 ASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFG-EFFASGSLDTNLKIWDIRKKGCIH 137 Query: 492 NFVAHEDG 515 + H G Sbjct: 138 TYKGHTRG 145 Score = 35.1 bits (77), Expect = 0.051 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +3 Query: 324 VKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVA 503 +K+ + K I GH GV+ + P V+ SG D V++WDLT K F + Sbjct: 125 LKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV-SGGEDNIVKVWDLTAGKLLTEFKS 183 Query: 504 HE 509 HE Sbjct: 184 HE 185 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEA 601 V L + PDG+ +S G+D +K W A Sbjct: 146 VNVLRFTPDGRWVVSGGEDNIVKVWDLTA 174 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 36.3 bits (80), Expect = 0.022 Identities = 19/68 (27%), Positives = 30/68 (44%) Frame = +3 Query: 312 ALNAVKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 A +KL + + L GHR ++ HP ASG+ D ++IWD+ + C Sbjct: 79 ASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFG-EFFASGSLDTNLKIWDIRKKGCIH 137 Query: 492 NFVAHEDG 515 + H G Sbjct: 138 TYKGHTRG 145 Score = 35.1 bits (77), Expect = 0.051 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +3 Query: 324 VKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVA 503 +K+ + K I GH GV+ + P V+ SG D V++WDLT K F + Sbjct: 125 LKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV-SGGEDNIVKVWDLTAGKLLTEFKS 183 Query: 504 HE 509 HE Sbjct: 184 HE 185 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEA 601 V L + PDG+ +S G+D +K W A Sbjct: 146 VNVLRFTPDGRWVVSGGEDNIVKVWDLTA 174 >At3g51930.1 68416.m05696 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); myosin heavy chain kinase B (SP:P90648)(GI:1903458) [Dictyostelium discoideum] Length = 415 Score = 36.3 bits (80), Expect = 0.022 Identities = 15/46 (32%), Positives = 27/46 (58%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 H D +S +A H ++ SG++D +++W L+ KC + AH+D Sbjct: 173 HADSISCLAVHAG---IIYSGSWDKTLKVWRLSDLKCLESIKAHDD 215 >At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat family protein contains seven WD-40 G-protein beta repeats; similar to RA-regulated nuclear matrix-associated protein (GI:14161320) {Homo sapiens} Length = 535 Score = 36.3 bits (80), Expect = 0.022 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 360 GCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 G L GH V +M HP+ +L SG+ DG +WDL Sbjct: 164 GVLIGHTGTVKSMCSHPTNSDLLVSGSRDGCFALWDL 200 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCT 488 L GH V+ + PS++ +A+ + D VR+W++ CT Sbjct: 377 LKGHDFEVTAVDWSPSEIGKVATASDDFTVRLWNIENNICT 417 >At2g22040.1 68415.m02617 transducin family protein / WD-40 repeat family protein similar to Pop3 (GI:3434986) [Schizosaccharomyces pombe]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak); Length = 312 Score = 36.3 bits (80), Expect = 0.022 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +3 Query: 423 VLASGAFDGEVRIWDLTVRKCTRNF 497 ++ SG+ DG V+IWDL VR+C R F Sbjct: 98 MMYSGSEDGSVKIWDLRVRECQREF 122 >At5g16750.1 68418.m01961 transducin family protein / WD-40 repeat family protein contains 8 WD-40 repeats (PF00400); similar to transducin homolog sazD - Homo sapiens, EMBL:U02609 Length = 876 Score = 35.9 bits (79), Expect = 0.029 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHE 509 ++G D ++ +A P + ++G ++R+WDL KC R++ HE Sbjct: 56 IEGESDTLTALALSPDDKLLFSAG-HSRQIRVWDLETLKCIRSWKGHE 102 Score = 35.9 bits (79), Expect = 0.029 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +3 Query: 372 GHRDGVSTMAKHP-SQLAVLASGAFDGEVRIWDLTVRKCTRNFVA 503 GH+ VS++ HP S +L SG+ D VR+WDL + + +A Sbjct: 142 GHKGVVSSILFHPDSNKNILISGSDDATVRVWDLNAKNTEKKCLA 186 Score = 34.7 bits (76), Expect = 0.067 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +2 Query: 551 FMSVGDDKTIKTWKAEAVTEEDEEPTNTLLSMSVVS 658 F+S D+T+K W + ++E+ EEP N L + SVV+ Sbjct: 462 FVSGSGDRTLKVWSLDGISEDSEEPIN-LKTRSVVA 496 Score = 31.1 bits (67), Expect = 0.83 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHE 509 GH V MA H S +LA+ D +V +WD+ CT F H+ Sbjct: 100 GHEGPVMGMACHASG-GLLATAGADRKVLVWDVDGGFCTHYFRGHK 144 >At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat family protein similar to katanin p80 subunit [Strongylocentrotus purpuratus] GI:3005601; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 871 Score = 35.9 bits (79), Expect = 0.029 Identities = 19/68 (27%), Positives = 30/68 (44%) Frame = +3 Query: 312 ALNAVKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 A +KL + + L GHR ++ HP ASG+ D ++IWD+ + C Sbjct: 172 ASGTIKLWDLEEAKVVRTLTGHRSNCVSVNFHPFG-EFFASGSLDTNLKIWDIRKKGCIH 230 Query: 492 NFVAHEDG 515 + H G Sbjct: 231 TYKGHTRG 238 Score = 35.5 bits (78), Expect = 0.039 Identities = 20/62 (32%), Positives = 30/62 (48%) Frame = +3 Query: 324 VKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVA 503 +K+ + K I GH GV+ + P ++ SG D V++WDLT K F + Sbjct: 218 LKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWIV-SGGEDNVVKVWDLTAGKLLHEFKS 276 Query: 504 HE 509 HE Sbjct: 277 HE 278 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEA 601 V L + PDG+ +S G+D +K W A Sbjct: 239 VNVLRFTPDGRWIVSGGEDNVVKVWDLTA 267 >At1g73720.1 68414.m08536 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8)[Drosophila melanogaster] Length = 511 Score = 35.9 bits (79), Expect = 0.029 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 423 VLASGAFDGEVRIWDLTVRKCTRNFVAHEDG 515 +LASG+ DG+++IW + C R F AH G Sbjct: 277 MLASGSQDGKIKIWRIRTGVCIRRFDAHSQG 307 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Frame = +2 Query: 521 ALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEPTNTLLSMSVVSGITHHRNKPIFATC 700 A C + G +G+DK + + ++ E ++ V GITHH ++ + AT Sbjct: 445 AACVSTKGDWIYCIGEDKKLYCFNYQSGGLEHF----MMVHEKDVIGITHHPHRNLLATY 500 Query: 701 GEQC--QLWE 724 E C +LW+ Sbjct: 501 SEDCTMKLWK 510 >At1g49450.1 68414.m05543 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein GI:2739374 from [Arabidopsis thaliana]; no characterized homologs Length = 471 Score = 35.9 bits (79), Expect = 0.029 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 H D VS ++ + L +L SG++D +++W L+ KC + AH+D Sbjct: 244 HFDAVSCLSLN-EDLGLLYSGSWDKTLKVWRLSDSKCLESIEAHDD 288 >At5g56130.1 68418.m07002 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GI:17225206) [Podospora anserina] Length = 315 Score = 35.1 bits (77), Expect = 0.051 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 L GH D V + P ++A+ + D VR+WD KCT+ Sbjct: 62 LKGHTDSVDQLCWDPKHSDLVATASGDKSVRLWDARSGKCTQ 103 >At5g25150.1 68418.m02981 transducin family protein / WD-40 repeat family protein similar to TBP-associated factor (GI:1732075) [Homo sapiens] and to 100 kDa subunit of Pol II transcription factor (GI:1491718) {Homo sapiens]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies)|8689032|gb|AV528749.1|AV528749 Length = 666 Score = 35.1 bits (77), Expect = 0.051 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAH 506 GHR V ++A P +ASG DG + +WDL+ +C + H Sbjct: 539 GHRSMVLSLAMSPDG-RYMASGDEDGTIMMWDLSTARCITPLMGH 582 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 405 HPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAH 506 HP+ +A+G+ D VR+WD+ +C R F+ H Sbjct: 508 HPN-CNYIATGSSDKTVRLWDVQTGECVRIFIGH 540 >At4g02730.1 68417.m00372 transducin family protein / WD-40 repeat family protein similar to C. elegans putative WD-repeat protein C14B1.4 (SP:Q17963) Length = 333 Score = 35.1 bits (77), Expect = 0.051 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAH 506 L GH + V + +P ++ SG+FD +RIW++ KC R AH Sbjct: 124 LRGHTNFVFCVNFNPPS-NLIVSGSFDETIRIWEVKTGKCVRMIKAH 169 Score = 33.1 bits (72), Expect = 0.21 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +3 Query: 318 NAVKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASG-AFDGEVRIW 464 N V L + A+ + L+GH D V +++ HP Q + +SG D +RIW Sbjct: 280 NCVYLWDLQARNILQRLEGHTDAVISVSCHPVQNEISSSGNHLDKTIRIW 329 >At5g08560.1 68418.m01018 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 589 Score = 34.3 bits (75), Expect = 0.089 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 L GH V+ ++ P+ L +LAS + DG +RIW L Sbjct: 527 LPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGL 561 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +2 Query: 509 GWVRALCYNPDGKHFM-SVGDDKTIKTWKAEAVTEEDEEPTNTLLSMSVVSGITHHRN 679 G V + ++P H + S DD TI+ W + + +++++ L+ S +G+ H N Sbjct: 532 GAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINQQNQK--KKLVQGSSSNGVIHRCN 587 >At3g05090.2 68416.m00553 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to uncharacterized KIAA1449 protein (gi:7959157) [Homo sapiens] Length = 753 Score = 34.3 bits (75), Expect = 0.089 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 L GH D V + + L SG+ D +R+WDL ++C + H D Sbjct: 251 LRGHTDNVRVLLLDSTGRFCL-SGSSDSMIRLWDLGQQRCLHTYAVHTD 298 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 H D V+ +A V+ASG GEV IWD+ Sbjct: 125 HSDYVTCLAVAAKNNNVVASGGLGGEVFIWDI 156 >At3g05090.1 68416.m00552 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to uncharacterized KIAA1449 protein (gi:7959157) [Homo sapiens] Length = 753 Score = 34.3 bits (75), Expect = 0.089 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 L GH D V + + L SG+ D +R+WDL ++C + H D Sbjct: 251 LRGHTDNVRVLLLDSTGRFCL-SGSSDSMIRLWDLGQQRCLHTYAVHTD 298 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 H D V+ +A V+ASG GEV IWD+ Sbjct: 125 HSDYVTCLAVAAKNNNVVASGGLGGEVFIWDI 156 >At4g34380.1 68417.m04884 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to Myosin heavy chain kinase B (MHCK B).(SP:P90648) [Dictyostelium discoideum] Length = 495 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 H D VS+++ +L +L S ++D +++W + KC + AH+D Sbjct: 234 HNDAVSSLSLDV-ELGLLYSSSWDTTIKVWRIADSKCLESIHAHDD 278 >At2g26490.1 68415.m03178 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); related to En/Spm transposon family of maize Length = 465 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 H D VS ++ + Q +L S ++D +++W + KC + AH+D Sbjct: 205 HADAVSCLSLNDEQ-GLLYSASWDRTIKVWRIADSKCLESIPAHDD 249 >At1g62020.1 68414.m06995 coatomer protein complex, subunit alpha, putative contains Pfam PF00400: WD domain, G-beta repeat; similar to Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) (SP:P53621) [Homo sapiens] Length = 1216 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRK 482 L+GH GV+ A HP+ L ++ SGA D +V++W + K Sbjct: 200 LEGHDRGVNWAAFHPT-LPLIVSGADDRQVKLWRMNETK 237 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 357 IGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL-TVRKCT 488 + L GH V + HP + V+ S + D VR+WD+ +RK T Sbjct: 128 VSVLTGHNHYVMCASFHPKEDLVV-SASLDQTVRVWDIGALRKKT 171 >At1g47610.1 68414.m05288 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein (GI:2739374) [Arabidopsis thaliana] Length = 351 Score = 33.5 bits (73), Expect = 0.16 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 3/92 (3%) Frame = +3 Query: 246 SENPRNYDP--SLHPL-EAPREYVRALNAVKLERVFAKPFIGCLDGHRDGVSTMAKHPSQ 416 S+NPR Y SL L + + V+ N V++ R +I H D VS ++ Q Sbjct: 92 SKNPRVYTRAGSLPALKDVLKSSVKPSNYVEVRRCRTALWIK----HSDAVSCLSLAEDQ 147 Query: 417 LAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 +L S ++D V++W + KC + AH+D Sbjct: 148 -GLLYSASWDRTVKVWRIHDLKCIESIKAHDD 178 >At4g15900.1 68417.m02416 PP1/PP2A phosphatases pleiotropic regulator 1 (PRL1) identical to PP1/PP2A phosphatases pleiotropic regulator PRL1 (SP:Q42384) [Arabidopsis thaliana], PRL1 [Arabidopsis thaliana] GI:577733; contains Pfam PF00400: WD domain, G-beta repeat (7 copies) Length = 486 Score = 33.1 bits (72), Expect = 0.21 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVR 479 GH GV +A HP+ L VL +G D R+WD+ + Sbjct: 258 GHLSGVYCLALHPT-LDVLLTGGRDSVCRVWDIRTK 292 Score = 32.7 bits (71), Expect = 0.27 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIKTW 589 GWVR++ ++P + F + D+TIK W Sbjct: 177 GWVRSVAFDPSNEWFCTGSADRTIKIW 203 Score = 31.9 bits (69), Expect = 0.48 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEPTN 631 + A CY+ G ++ DKTIK WK + + P N Sbjct: 438 IYAACYDNTGSRLVTCEADKTIKMWKEDENATPETHPIN 476 >At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana]; contains non-consensus (GC) donor splice sites at introns 4 and 6 Length = 1017 Score = 33.1 bits (72), Expect = 0.21 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 426 LASGAFDGEVRIWDLTVRKCTRNFVAHE 509 LAS +DG V++WD+T + +F+ HE Sbjct: 769 LASSDYDGIVKLWDVTTGQAISHFIEHE 796 >At2g47410.1 68415.m05917 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to WDR protein, form B (GI:14970593) [Mus musculus] Length = 1589 Score = 33.1 bits (72), Expect = 0.21 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 357 IGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 + CL GH + + HP + S +DG+ IWD+ Sbjct: 632 VHCLTGHSESSYVLDVHPFNPRIAMSAGYDGKTIIWDI 669 >At1g52730.2 68414.m05959 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to UNR-interacting protein (WD-40 repeat protein PT-WD) (SP:Q9Y3F4) [Homo sapiens] Length = 343 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +3 Query: 357 IGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 IGC GH V + P+ L+ ASG+ DG +RIW T Sbjct: 263 IGCNKGHHGPVHCVRFTPTGLSY-ASGSEDGTIRIWQTT 300 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEPTNTLLSMSV 652 G V + + P G + S +D TI+ W+ E+ E ++ + SV Sbjct: 271 GPVHCVRFTPTGLSYASGSEDGTIRIWQTTPANPEENETSSRRVKHSV 318 >At1g52730.1 68414.m05958 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to UNR-interacting protein (WD-40 repeat protein PT-WD) (SP:Q9Y3F4) [Homo sapiens] Length = 343 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +3 Query: 357 IGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 IGC GH V + P+ L+ ASG+ DG +RIW T Sbjct: 263 IGCNKGHHGPVHCVRFTPTGLSY-ASGSEDGTIRIWQTT 300 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEPTNTLLSMSV 652 G V + + P G + S +D TI+ W+ E+ E ++ + SV Sbjct: 271 GPVHCVRFTPTGLSYASGSEDGTIRIWQTTPANPEENETSSRRVKHSV 318 >At3g16650.1 68416.m02128 PP1/PP2A phosphatases pleiotropic regulator 2 (PRL2) identical to SP|Q39190 PP1/PP2A phosphatases pleiotropic regulator PRL2 {Arabidopsis thaliana}, GB:Q39190 from [Arabidopsis thaliana]; contains Pfam PF00400: WD domain, G-beta repeat (7 copies, 1 weak) Length = 479 Score = 32.7 bits (71), Expect = 0.27 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIKTW 589 GWVR++ ++P + F + D+TIK W Sbjct: 171 GWVRSVAFDPSNEWFCTGSADRTIKIW 197 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEPTN 631 + A CY+ G ++ DKTIK WK + + P N Sbjct: 431 IYAACYDQTGSRLVTCEGDKTIKMWKEDEDATPETHPLN 469 Score = 31.5 bits (68), Expect = 0.63 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVR 479 GH GV +A HP+ L V+ +G D R+WD+ + Sbjct: 252 GHLHGVYCLALHPT-LDVVLTGGRDSVCRVWDIRTK 286 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIKTWKAE 598 G VR L + + S GDDK +K W E Sbjct: 213 GQVRGLAVSNRHTYMFSAGDDKQVKCWDLE 242 >At2g21390.1 68415.m02546 coatomer protein complex, subunit alpha, putative contains Pfam PF00400: WD domain, G-beta repeat; similar to Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) (SP:P53621) [Homo sapiens] Length = 1218 Score = 32.7 bits (71), Expect = 0.27 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRK 482 L+GH GV+ + HP+ L ++ SGA D +V++W + K Sbjct: 200 LEGHDRGVNWASFHPT-LPLIVSGADDRQVKLWRMNETK 237 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 357 IGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRK 482 I L GH V + HP + V+ S + D VR+WD+ K Sbjct: 128 ISVLTGHNHYVMCASFHPKEDLVV-SASLDQTVRVWDIGALK 168 >At2g19430.1 68415.m02267 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 5 (SP:Q9UGP9) [Homo sapiens]; contains 7 Trp-Asp WD-40 repeats Length = 367 Score = 32.7 bits (71), Expect = 0.27 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 GH D + T+ S +L +G+ DG RIWD KC + Sbjct: 199 GHSDYLHTVVSRSSASQIL-TGSEDGTARIWDCKTGKCVK 237 >At4g32990.1 68417.m04692 transducin family protein / WD-40 repeat family protein HIRA protein, Drosophila melanogaster, PID:e1250847 Length = 318 Score = 31.9 bits (69), Expect = 0.48 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWD 467 L+GH D V +A +P+ V+AS + D VRIW+ Sbjct: 16 LEGHTDRVWNVAWNPAADGVIASCSADKTVRIWE 49 >At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1102 Score = 31.9 bits (69), Expect = 0.48 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +3 Query: 357 IGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 +G L H+ V + + +LASGA DGE+ IWDL Sbjct: 115 VGHLSVHKGPVRGLEFNAISSNLLASGADDGEICIWDL 152 >At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1104 Score = 31.9 bits (69), Expect = 0.48 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +3 Query: 357 IGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 +G L H+ V + + +LASGA DGE+ IWDL Sbjct: 115 VGHLSVHKGPVRGLEFNAISSNLLASGADDGEICIWDL 152 >At2g47990.1 68415.m06006 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina}; contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GP:17225206)[Podospora anserina] Length = 530 Score = 31.9 bits (69), Expect = 0.48 Identities = 20/60 (33%), Positives = 30/60 (50%) Frame = +3 Query: 324 VKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVA 503 VK V I L GH+D V P ++L +G++D V++WD V T N++A Sbjct: 160 VKYWDVAGATVISDLLGHKDYVRCGDCSPVNDSMLVTGSYDHTVKVWDARVH--TSNWIA 217 >At3g50390.1 68416.m05512 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to myosin heavy chain kinase B (gb:U90946) [Dictyostelium discoideum] Length = 469 Score = 31.5 bits (68), Expect = 0.63 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 H D +S +A + +L SG++D ++W ++ +C + AHED Sbjct: 210 HLDAISCLALSEDK-RLLYSGSWDKTFKVWRVSDLRCVESVNAHED 254 >At3g18060.1 68416.m02297 transducin family protein / WD-40 repeat family protein similar to 66 kDa stress protein (SP:P90587) [Physarum polycephalum (Slime mold)]; similar to WDR1 protein GB:AAD05042 [Gallus gallus] (Genomics 56 (1), 59-69 (1999)); contains 11 WD-40 repeats (PF00400) Length = 609 Score = 31.5 bits (68), Expect = 0.63 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEPTNTLLSMSVVSG 661 G + A+ ++PDGK ++V DK+ K W +++ NT L+ SG Sbjct: 233 GSIYAVSWSPDGKQVLTVSADKSAKIWD---ISDNGSGSLNTTLNCPGSSG 280 >At2g30050.1 68415.m03654 transducin family protein / WD-40 repeat family protein similar to SEC13-related protein (SP:P55735) [Homo sapiens] Length = 302 Score = 31.5 bits (68), Expect = 0.63 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 357 IGCLDGHRDGVSTMA-KHPSQLAVLASGAFDGEVRIW 464 + L GHR V +A HP ++LAS ++DG+V +W Sbjct: 49 LATLTGHRGPVWEVAWAHPKYGSILASCSYDGQVILW 85 >At2g19540.1 68415.m02283 transducin family protein / WD-40 repeat family protein contains WD-40 repeats (PF00400); similar to Glutamate-rich WD repeat protein (GRWD) (SP:Q9BQ67)[Homo sapiens] Length = 469 Score = 31.5 bits (68), Expect = 0.63 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKC-TRNFVAH 506 GH V + P++ V AS + DG V +WD+ + K +F AH Sbjct: 267 GHTASVEDLQWSPAEENVFASCSVDGSVAVWDIRLGKSPALSFKAH 312 >At1g71840.1 68414.m08302 transducin family protein / WD-40 repeat family protein contains Pfam profile:PF00560 Leucine Rich Repeat (4 copies); Pfam profile:PF00069 Eukaryotic protein kinase domain; Pfam profile:PF00400 WD domain, G-beta repeat (7 copies) Length = 407 Score = 31.5 bits (68), Expect = 0.63 Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +3 Query: 366 LDGHRDGVSTMA-KHPSQLAVLASGAFDGEVRIWD 467 L GH+D VS +A + QL LASG DG V+I+D Sbjct: 109 LPGHKDSVSCLAFSYDGQL--LASGGLDGVVQIFD 141 Score = 31.5 bits (68), Expect = 0.63 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 H +GV+++ + LA+G +G V IWD + C + H+D Sbjct: 327 HEEGVTSLTWIGTS-KYLATGCANGTVSIWDSLLGNCVHTYHGHQD 371 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 31.1 bits (67), Expect = 0.83 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 405 HPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 +P++ LAS +FD V++WD + K +F H + Sbjct: 507 NPNKQLTLASASFDSTVKLWDAELGKMLCSFNGHRE 542 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +3 Query: 369 DGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAH 506 +GHR+ V ++A P+ +ASG+ D + IW + K + + + Sbjct: 538 NGHREPVYSLAFSPNG-EYIASGSLDKSIHIWSIKEGKIVKTYTGN 582 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 L+GH V A PS ++LASG+ D RIW + Sbjct: 261 LEGHTSEVCACAWSPSA-SLLASGSGDATARIWSI 294 >At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 709 Score = 31.1 bits (67), Expect = 0.83 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 H+ V+ +A +P SG+ DG+VRIWD++ Sbjct: 403 HKSFVTCVAFNPVDDNYFISGSIDGKVRIWDVS 435 >At5g11240.1 68418.m01313 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); similar to uncharacterized protein KIAA0007 (GI:1663708) {Homo sapiens} 1.2e-11 Length = 615 Score = 31.1 bits (67), Expect = 0.83 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Frame = +2 Query: 467 FNCTEVYK--KFCCS*GWVRALCYNPDGKHFMSVG-DDKTIKTWKAEAVTEE 613 FNC+++ K KF G VR + + DGK+ +S ++ I WK + ++ Sbjct: 183 FNCSDLKKIQKFTGHPGVVRCVAFTEDGKYVLSSAVGERYIAVWKTDGAKKQ 234 >At3g21540.1 68416.m02717 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (10 copies); similar to WD-repeat protein 3 (SP:Q9UNX4) [Homo sapiens] Length = 955 Score = 31.1 bits (67), Expect = 0.83 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 387 VSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHE 509 V+++A S L +A G DG +RIWD C NF +H+ Sbjct: 68 VTSIASSASSL--VAVGYADGSIRIWDTEKGTCEVNFNSHK 106 >At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat family protein similar to Transcriptional repressor rco-1 (SP:P78706) [Neurospora crassa]; similar to TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400) Length = 648 Score = 31.1 bits (67), Expect = 0.83 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 345 AKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRK 482 ++P I H D + T K S +L S +FDG +++WDL K Sbjct: 362 SRPDIYVGKAHTDDI-TSVKFSSDGRILLSRSFDGSLKVWDLRQMK 406 >At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 protein (ZFWD2), putative 99.8% identical to zfwd2 protein (GI:12057166) [Arabidopsis thaliana]; contains 6 copies (2 weak) Pfam PF00400: WD domain, G-beta repeat; contains Pfam PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) domain Length = 437 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCT 488 LDGH VS +A PS L +G+ D +R+WD +CT Sbjct: 147 LDGHEKLVSGIAL-PSGSDKLYTGSKDETLRVWDCASGQCT 186 >At2g46280.2 68415.m05756 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 328 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIK 583 G + AL +NPDGK F S G+D ++ Sbjct: 291 GPINALAFNPDGKSFSSGGEDGYVR 315 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEAVT 607 + +LC D HF++ DKT K W +T Sbjct: 196 ITSLCKAADDSHFLTGSLDKTAKLWDMRTLT 226 >At2g46280.1 68415.m05755 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 328 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIK 583 G + AL +NPDGK F S G+D ++ Sbjct: 291 GPINALAFNPDGKSFSSGGEDGYVR 315 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEAVT 607 + +LC D HF++ DKT K W +T Sbjct: 196 ITSLCKAADDSHFLTGSLDKTAKLWDMRTLT 226 >At1g24530.1 68414.m03088 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina}; contains 7 WD-40 repeats (PF00400) Length = 418 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = +3 Query: 366 LDGHRDGVSTMA----KHPSQLAVLASGAFDGEVRIWDLTVRKCTRNF 497 L GH V ++A K + + SG+ DGEV+ W ++V K +F Sbjct: 365 LSGHTKPVKSLAAVREKELDDVVSIISGSLDGEVKCWKVSVTKPDNSF 412 >At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to pre-mRNA splicing factor PRP17 (SP:O60508) [Homo sapiens] Length = 457 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 387 VSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFV 500 V + HP V SG G +R+WD+ K +V Sbjct: 249 VGVVKFHPDNCNVFLSGGSKGSLRLWDIRANKFVHEYV 286 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL--TVRKCTRNFVAH 506 L GH V+ + S + +LAS DG V +W++ +K R F+ H Sbjct: 156 LTGHTKAVTAIDWSTSHVHLLASAGLDGAVYVWNVWSNDKKKVRAFLHH 204 >At5g21040.1 68418.m02503 F-box family protein / WD-40 repeat family protein contains G-protein beta WD-40 repeats Length = 539 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHED 512 GH ++++A + + SG++D VRIWD + KC + + H D Sbjct: 255 GHEGPITSLAL---DMTSIFSGSWDMSVRIWDRSSMKCVKT-LRHSD 297 >At4g35370.1 68417.m05025 transducin family protein / WD-40 repeat family protein contains 4 (3 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 414 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 423 VLASGAFDGEVRIWDLTVRKCTRNFVAHE 509 ++ASG+ D +V++WD+ KC HE Sbjct: 229 IVASGSEDKKVKVWDVATGKCKVTMEHHE 257 >At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) contains seven G-protein beta WD-40 repeats; beta transducin-like protein, Podospora anserina, gb:L28125; contains Pfam profiles PF04503: Single-stranded DNA binding protein, SSDP; PF00400:WD domain, G-beta repeat; identical to cDNA LEUNIG (LEUNIG) GI:11141604 Length = 931 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 GH V+++ HP + ++ S D E+R W + CTR Sbjct: 734 GHSSMVTSLDFHPIKDDLICSCDNDNEIRYWSINNGSCTR 773 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCT-RNFVAH 506 L+ H ++ + PSQL LA+ +FD VR+WD + + R F+ H Sbjct: 689 LEEHTAMITDIRFSPSQLR-LATSSFDKTVRVWDADNKGYSLRTFMGH 735 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 426 LASGAFDGEVRIWDLTVRKCTRNFVAH 506 LASG D + RIWDL +RK AH Sbjct: 438 LASGGEDNQCRIWDLRMRKSLYIIPAH 464 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEE 622 V +L D +V D+TIK W + +EDEE Sbjct: 511 VASLDITADSSCIATVSHDRTIKLWTSSGNDDEDEE 546 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +3 Query: 354 FIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 F+ + GH V ++ HP + +L S + ++R WD+ C R Sbjct: 585 FLRTISGHAAPVMSIDFHPKKTELLCSCDSNNDIRFWDINA-SCVR 629 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +3 Query: 354 FIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 F+ + GH V ++ HP + +L S + ++R WD+ C R Sbjct: 587 FLRTISGHAAPVMSIDFHPKKTELLCSCDSNNDIRFWDINA-SCVR 631 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +3 Query: 354 FIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 F+ + GH V ++ HP + +L S + ++R WD+ C R Sbjct: 587 FLRTISGHAAPVMSIDFHPKKTELLCSCDSNNDIRFWDINA-SCVR 631 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +3 Query: 354 FIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 F+ + GH V ++ HP + +L S + ++R WD+ C R Sbjct: 587 FLRTISGHAAPVMSIDFHPKKTELLCSCDSNNDIRFWDINA-SCVR 631 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +3 Query: 354 FIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 F+ + GH V ++ HP + +L S + ++R WD+ C R Sbjct: 587 FLRTISGHAAPVMSIDFHPKKTELLCSCDSNNDIRFWDINA-SCVR 631 >At2g05720.1 68415.m00613 transducin family protein / WD-40 repeat family protein Similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (gi:2708305)[Homo sapiens]; contains 4 WD-40 repeats Length = 276 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 426 LASGAFDGEVRIWDLTVRKCTRNFVAH 506 LASG D + RIWDL +RK AH Sbjct: 187 LASGGEDNQCRIWDLRMRKLLYIIPAH 213 >At1g24130.1 68414.m03044 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400);similar to beta transducin-like protein HET-D2Y (GI:17225210) [Podospora anserina]. Length = 415 Score = 30.3 bits (65), Expect = 1.5 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEPTNTLLSMSVVSGITHHR 676 V AL + DGK S D++I W+ + +DEE L MSVV + HR Sbjct: 281 VNALAISEDGKVLYSGACDRSILVWE-RLINGDDEE-----LHMSVVGALRGHR 328 >At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 698 Score = 29.9 bits (64), Expect = 1.9 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIKTW 589 G + A+ ++PDG++ S G+D ++ W Sbjct: 252 GAILAMKFSPDGRYLASAGEDGVLRVW 278 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +3 Query: 318 NAVKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIW 464 N+V+L ++ + +G H + V+++ +P SG+ DG+VRIW Sbjct: 377 NSVRLWQIGCEDCLGIFS-HNNYVTSVQFNPVDDDHFISGSIDGKVRIW 424 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +2 Query: 530 YNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEP 625 + DGKH +S DD ++ W E P Sbjct: 543 FTADGKHIVSACDDSSVYVWNCVGHDPEQSSP 574 >At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 694 Score = 29.9 bits (64), Expect = 1.9 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIKTW 589 G + A+ ++PDG++ S G+D ++ W Sbjct: 252 GAILAMKFSPDGRYLASAGEDGVLRVW 278 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +3 Query: 318 NAVKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIW 464 N+V+L ++ + +G H + V+++ +P SG+ DG+VRIW Sbjct: 377 NSVRLWQIGCEDCLGIFS-HNNYVTSVQFNPVDDDHFISGSIDGKVRIW 424 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +2 Query: 530 YNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEP 625 + DGKH +S DD ++ W E P Sbjct: 539 FTADGKHIVSACDDSSVYVWNCVGHDPEQSSP 570 >At4g01860.2 68417.m00244 transducin family protein / WD-40 repeat family protein contains ten G-protein beta-subunit (beta-transducin) WD-40 repeats Length = 1308 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 411 SQLAVLASGAFDGEVRIWDLTVRKCTRNFV 500 S + +L SGA DG + WD+T KC FV Sbjct: 1032 SDVYLLISGATDGSIGFWDVT--KCVEAFV 1059 >At4g01860.1 68417.m00243 transducin family protein / WD-40 repeat family protein contains ten G-protein beta-subunit (beta-transducin) WD-40 repeats Length = 1308 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 411 SQLAVLASGAFDGEVRIWDLTVRKCTRNFV 500 S + +L SGA DG + WD+T KC FV Sbjct: 1032 SDVYLLISGATDGSIGFWDVT--KCVEAFV 1059 >At4g00090.1 68417.m00009 transducin family protein / WD-40 repeat family protein similar to Transducin beta-like 2 protein (WS beta-transducin repeats protein) (WS-betaTRP) (Williams-Beuren syndrome chromosome region 13 protein) (SP:Q9Y4P3) {Homo sapiens} Length = 430 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVR 479 L GH+ V+ + P+ ++ + DG +R+W++ VR Sbjct: 285 LKGHKSAVTWLCFSPNSEQIITASK-DGSIRVWNINVR 321 Score = 28.3 bits (60), Expect = 5.9 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = +2 Query: 524 LCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEP 625 LC++P+ + ++ D +I+ W DE+P Sbjct: 295 LCFSPNSEQIITASKDGSIRVWNINVRYHLDEDP 328 >At3g44530.1 68416.m04786 transducin family protein / WD-40 repeat family protein contains 6 (4 significant) WD-40 repeats (PF0400); nuclear protein HIRA, mouse, PIR:S68141 Length = 1051 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAH 506 L GH V + P ++LASG+ D V IW++ CT H Sbjct: 114 LRGHTADVVDLNWSPDD-SMLASGSLDNTVHIWNMRTGMCTTVLRGH 159 >At2g40360.1 68415.m04977 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to block of proliferation protein Bop1 (GI:1679772) [Mus musculus] Length = 753 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTR 491 GH V++++ S +ASG+ DG VR+W++ +C + Sbjct: 421 GHTGAVTSISTDSSG-EWIASGSTDGSVRMWEVETGRCLK 459 >At1g21650.1 68414.m02710 preprotein translocase secA family protein contains Pfam profiles: PF01043 SecA protein, amino terminal region, PF00400 WD domain, G-beta repeat, PF00097 zinc finger, C3HC4 type (RING finger) Length = 1579 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 + GH+ VST+ VL SG++DG VR+W L+ Sbjct: 623 MSGHKSVVSTLVVVNG---VLYSGSWDGTVRLWSLS 655 >At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 654 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = +3 Query: 324 VKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 V+L +V + +G H V+++ +P SG+ DG+VRIW+++ Sbjct: 351 VRLWKVGSNDCLGVF-AHNSYVTSVQFNPVNENYFMSGSIDGKVRIWNIS 399 >At5g48800.1 68418.m06038 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 614 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 333 LILQHSKHAHIHGVLLVDASSGHSCEDFL 247 L+LQH +H H H L + SS SC +++ Sbjct: 9 LLLQHHQHLHHHQKLSLAKSSRQSCSEWI 37 >At5g15550.2 68418.m01821 transducin family protein / WD-40 repeat family protein similar to YTM1 - Homo sapiens, EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta repeat (7 copies,1 weak); Length = 402 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRN 494 H +S H S L S ++DG++ +WDL T++ Sbjct: 357 HSSWISACKWHKSSWFHLLSASYDGKIMLWDLRTAVMTKH 396 >At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 WD-40 repeats (PF0400); similar to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 496 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 369 DGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWD 467 +GHR V + P + +V S A DG + IWD Sbjct: 372 EGHRAAVLCVQWSPDKSSVFGSSAEDGLLNIWD 404 >At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 protein (ZFWD1) identical to zfwd1 protein (GI:12057164) [Arabidopsis thaliana] Length = 430 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCT 488 LDGH+ V+ +A PS L + + D VRIWD +CT Sbjct: 140 LDGHQKVVTGIAL-PSGSDKLYTASKDETVRIWDCASGQCT 179 >At3g01340.1 68416.m00051 protein transport protein SEC13 family protein / WD-40 repeat family protein similar to Protein transport protein SEC13 SP|Q04491 {Saccharomyces cerevisiae} and SEC13 (SP:P53024) [Pichia pastoris] Length = 302 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 357 IGCLDGHRDGVSTMA-KHPSQLAVLASGAFDGEVRIW 464 + L GHR V +A HP ++LAS ++DG++ +W Sbjct: 49 LATLTGHRGPVWQVAWAHPKFGSLLASCSYDGQIILW 85 >At2g46290.1 68415.m05758 eukaryotic translation initiation factor 3 subunit 2, putative / eIF-3 beta, putative / eIF3i, putative strong similarity to SP|Q38884 Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (eIF3i) (TGF-beta receptor interacting protein 1) (TRIP-1) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies)|19799885|gb|AU231175.1|AU231175 Length = 355 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEAVT 607 + +LC D HF++ DKT K W +T Sbjct: 223 ITSLCKAADDSHFLTGSHDKTAKLWDMRTLT 253 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIK 583 G + AL ++PDGK F S G+D ++ Sbjct: 318 GPINALAFSPDGKSFSSGGEDGYVR 342 >At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to U5 snRNP-specific 40 kDa protein (GI:3820594) [Homo sapiens] Length = 343 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL----TVRKCTRNFVAHE 509 L+GH+D ++ M+ P +L +G D ++ +WD+ +C + F H+ Sbjct: 218 LEGHQDTITGMSLSPDGSYLLTNG-MDNKLCVWDMRPYAPQNRCVKIFEGHQ 268 >At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens]; similar to rab11 binding protein GI:4512103 from [Bos taurus] Length = 593 Score = 29.5 bits (63), Expect = 2.5 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIKTWK 592 G + L ++PDGK+ + G+D +K W+ Sbjct: 199 GKIWTLKFSPDGKYLATGGEDGVVKIWR 226 >At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless protein, putative similar to notchless [Xenopus laevis] GI:3687833; contains Pfam PF00400: WD domain, G-beta repeat (8 copies) Length = 473 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAV----LASGAFDGEVRIWDLTVRK 482 L GH+ ++ ++ P L+ + + DG+ RIWD+T++K Sbjct: 190 LTGHKKWITGISWEPVHLSSPCRRFVTSSKDGDARIWDITLKK 232 Score = 28.7 bits (61), Expect = 4.4 Identities = 20/82 (24%), Positives = 34/82 (41%), Gaps = 4/82 (4%) Frame = +2 Query: 512 WVRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEPTNTLLSMSVVSGITHHRNKPI- 688 WV + ++PDGKH +S I W + E T ++ +S H + P Sbjct: 153 WVLTVAWSPDGKHLVSGSKSGEICCWNPKKGELEGSPLTGHKKWITGISWEPVHLSSPCR 212 Query: 689 -FATCGE--QCQLWENTRNEPI 745 F T + ++W+ T + I Sbjct: 213 RFVTSSKDGDARIWDITLKKSI 234 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWK 592 V A+ ++PDG+ +S G D+ +K WK Sbjct: 447 VFAVDWSPDGEKVVSGGKDRVLKLWK 472 >At5g50120.1 68418.m06207 transducin family protein / WD-40 repeat family protein Similar to En/Spm-like transposon protein (gi:2739374)[Arabidopsis thaliana]; similar to GTP-binding regulatory protein and WD-repeat protein; contains 7 WD-40 repeats Length = 388 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +3 Query: 315 LNAVKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWD 467 +N +++ + L H G++ +A + ++L SG DG + +W+ Sbjct: 238 INEENVKKKRKHSLVAILSEHNSGINALALSGTNGSLLHSGGSDGSILVWE 288 >At5g49430.1 68418.m06116 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 9 (SP:Q9NSI6) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies) Length = 1677 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 L GH M HP + S +DG+ +WD+ Sbjct: 582 LTGHTASTYVMDVHPFNPRIAMSAGYDGKTIVWDI 616 >At4g18905.1 68417.m02787 transducin family protein / WD-40 repeat family protein contains 5 (4 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 494 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/30 (40%), Positives = 22/30 (73%) Frame = +3 Query: 384 GVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 GVS+++ + S +LA+G+ D V++WDL+ Sbjct: 406 GVSSISYNISTPNLLATGSMDKSVKLWDLS 435 >At4g18900.1 68417.m02786 transducin family protein / WD-40 repeat family protein contains 5 (4 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 461 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/36 (30%), Positives = 25/36 (69%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 ++GH + ++++ + S +LA+G+ D V++WDL+ Sbjct: 365 INGHDEAATSVSYNISAPNLLATGSKDRTVKLWDLS 400 >At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 387 VSTMAKHPSQLAVLASGAFDGEVRIWDLTVRK 482 V +M HPS +LA G GEV +W++ R+ Sbjct: 350 VISMDFHPSHHTLLAVGCSSGEVTLWEVGSRE 381 >At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogenesis repressor; identical to COP1 regulatory protein/FUSCA protein FUS1 GI:402685 SP:P43254 Length = 675 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +3 Query: 378 RDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHE 509 R +S ++ + + +AS ++G V +WD+T R+ + HE Sbjct: 420 RSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHE 463 >At5g64730.1 68418.m08140 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8) [Fruit fly] {Drosophila m.] Length = 299 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = +2 Query: 458 YLGFNCTEVYKKFCCS*GWVRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEPTNTL 637 Y + V +KF G V A+ +N +S G D++++ W + + E + +T Sbjct: 86 YWDVSTGRVIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVEPVQIIDTF 145 Query: 638 LS--MSVV 655 L MSVV Sbjct: 146 LDTVMSVV 153 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIKTW 589 G V A +N DG + ++ G D+TI+ W Sbjct: 19 GAVLAARFNGDGNYALTCGKDRTIRLW 45 >At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 WD-40 repeats (PF00400) (2 weak) Length = 1108 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 387 VSTMAKHPSQLAVLASGAFDGEVRIWDLTVRK 482 V++M +P Q +L G+ GE+ +W+L R+ Sbjct: 348 VTSMEFYPMQNTLLLVGSATGEITLWELAARE 379 >At3g15610.1 68416.m01980 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to serine/threonine kinase receptor associated protein GB:NP_035629 (SP:Q9Z1Z2) [Mus musculus]; UNR-interacting protein GB:NP_009109 [Homo sapiens] Length = 341 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 357 IGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIW 464 IGC GH V + P+ + ASG+ DG +RIW Sbjct: 263 IGCNKGHHGPVHCVRFAPTGESY-ASGSEDGTIRIW 297 >At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 883 Score = 28.7 bits (61), Expect = 4.4 Identities = 23/102 (22%), Positives = 42/102 (41%), Gaps = 2/102 (1%) Frame = +3 Query: 210 PRRLFARYETRYSENPRNYDPSLHPLEAPREYVRALNAVKLERVFAKPFIGCLD--GHRD 383 P LF E + + D L + +++ + + K R++ CL H D Sbjct: 495 PDSLFGLSEKPFCSFQGHVDDVLDLAWSKSQHLLSSSMDKTVRLWNLSSQTCLKVFSHSD 554 Query: 384 GVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRNFVAHE 509 V+ + +P SG+ D +VR+W + R+ + HE Sbjct: 555 YVTCIQFNPVDDRYFISGSLDAKVRVWSIPDRQVVDWYDLHE 596 >At2g17470.1 68415.m02017 expressed protein contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 538 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = +2 Query: 539 DGKHFMSVGDDKTIKTW-KAEAVT-EEDEEPTNTLLSMSVVSGITHHRNKPIFATCGEQC 712 D K ++ V + T KAEA EE+ T + S+S + N A+ ++ Sbjct: 374 DSKSYLLVNSESWAATKEKAEAEEYEEEAHETKVIKSLSQIWDTNSSSNNQNPASGNDES 433 Query: 713 QLWENTRN 736 Q+WE+T + Sbjct: 434 QIWESTES 441 >At2g01330.1 68415.m00050 transducin family protein / WD-40 repeat family protein contains 10 WD-40 repeats (PF00400); similar to 66kDa stress protein (SWISS-PROT: P90587)[ Physarum polycephalum (Slime mold)] Length = 474 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 509 GWVRALCYNPDGKHFMSVGDDKTIKTWK 592 G + A+ ++PD K ++V DK+ K W+ Sbjct: 97 GSIYAVSWSPDSKRVLTVSADKSAKVWE 124 >At1g18830.1 68414.m02345 transducin family protein / WD-40 repeat family protein similar to Sec31p (GI:13928450) {Oryza sativa} Length = 969 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = +3 Query: 384 GVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 G+ K P+QLA SGA DG V IWDL Sbjct: 120 GLEFNVKSPNQLA---SGADDGTVCIWDL 145 >At5g40880.1 68418.m04964 WD-40 repeat family protein / zfwd3 protein (ZFWD3) contains 5 WD-40 repeats (PF00400); contains Zinc finger C-x8-C-x5-C-x3-H type domain (PF00642); identical to zfwd3 protein (GP:12057168) {Arabidopsis thaliana} Length = 472 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +3 Query: 357 IGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRN 494 + L+GH++ + +A P L S + DG + IWD +C R+ Sbjct: 180 VAALEGHKNDIKGIAL-PQGSDKLFSVSGDGTLLIWDCNSGQCVRS 224 >At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pfam profile PF00400: WD domain, G-beta repeat Length = 580 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/49 (26%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASG---AFDGEVRIWDLTVRKCTRNFVAHED 512 H + ++ + V SG F G V+ W+L C ++ AHE+ Sbjct: 232 HHGALRSLVVSEDECTVFTSGIDPGFKGSVQKWELASLSCVSSYHAHEE 280 >At5g15550.1 68418.m01820 transducin family protein / WD-40 repeat family protein similar to YTM1 - Homo sapiens, EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta repeat (7 copies,1 weak); Length = 433 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 H +S H S L S ++DG++ +WDL Sbjct: 357 HSSWISACKWHKSSWFHLLSASYDGKIMLWDL 388 >At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); rab11 binding protein, Bos taurus, EMBL:AF117897 Length = 905 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRK 482 L H D V+ + +P SG+ D ++RIW+++ R+ Sbjct: 555 LFAHNDYVTCVQFNPLDEDYFISGSLDAKIRIWNISNRQ 593 >At4g03020.1 68417.m00410 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to L. erythrorhizon LEC14B, GenBank accession number Q40153 Length = 493 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +2 Query: 539 DGKHFMSVGDDKTIKTW 589 DG++F+S G D+TIK W Sbjct: 329 DGRYFISNGKDQTIKLW 345 >At2g46280.3 68415.m05757 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 254 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEAVT 607 + +LC D HF++ DKT K W +T Sbjct: 196 ITSLCKAADDSHFLTGSLDKTAKLWDMRTLT 226 >At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 (4 significant) WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 507 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 369 DGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWD 467 +GH+ V + P + +V S A DG + IWD Sbjct: 383 EGHKAAVLCVQWSPDKSSVFGSSAEDGLLNIWD 415 >At2g16780.1 68415.m01924 WD-40 repeat protein (MSI2) contains 5 WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI2 (SP:O22468) [Arabidopsis thaliana] WD-40 repeats (PF0400); Length = 415 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/65 (21%), Positives = 27/65 (41%) Frame = +3 Query: 315 LNAVKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCTRN 494 ++A ++V F+ +GH ++ ++ H + S DG + IWD + Sbjct: 198 VSATPQDKVLNAMFV--YEGHESAIADVSWHMKNENLFGSAGEDGRLVIWDTRTNQMQHQ 255 Query: 495 FVAHE 509 HE Sbjct: 256 VKVHE 260 >At1g49540.1 68414.m05553 transducin family protein / WD-40 repeat family protein similar to signal transducer and activator of transcription interacting protein 1 (GI:15929722) {Mus musculus}; similar to hypothetical protein GB:AAD43147 GI:5430747 from (Arabidopsis thaliana); contains Pfam PF00400: WD domain, G-beta repeat (11 copies, 2 weak) Length = 840 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 521 ALCYNPDGKHFMSVGDDKTIKTWKAE 598 A +NP G F + DKT+K W E Sbjct: 701 ACSWNPFGHQFATSSRDKTVKIWSVE 726 >At5g63010.1 68418.m07905 WD-40 repeat family protein contains 4 WD-40 repeats (PF00400);low similarity to photomorphogenesis repressor (COP1) GI:2702280 [Arabidopsis thaliana] and COP1 GI:11127996 [Ipomoea nil] Length = 343 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +3 Query: 375 HRDGVSTMAKHPSQLAVLASGAFDGEVRIWD 467 H GV ++ +PS + +G++D +R+WD Sbjct: 209 HTMGVCCISSNPSDPYSIFTGSYDETLRVWD 239 >At5g50230.1 68418.m06221 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to TIPD PROTEIN (SP:O15736)[Dictyostelium discoideum] Length = 515 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 366 LDGHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLTVRKCT 488 L GH D V + + S A+D +++WDL CT Sbjct: 311 LTGHTDKVCAVDVSKFSSRHVVSAAYDRTIKLWDLHKGYCT 351 >At4g35140.1 68417.m04996 transducin family protein / WD-40 repeat family protein contains 6 (3 significant) WD-40 repeats; similar to PC326 protein (GI:200241) (PIR2:S37694) [Mus musculus]; Human (H326) mRNA, Homo sapiens, gb:U06631 Length = 496 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 479 EVYKKFCCS*GWVRALCYNPDGKHFMSVGDDKTIKTW 589 E+YKK G V + +N +G +S DD+ + W Sbjct: 50 EIYKKLEKHKGCVNTVSFNAEGDVLISGSDDRRVVLW 86 >At4g02290.1 68417.m00310 glycosyl hydrolase family 9 protein similar to endo-1,4-beta glucanase; ATCEL2 GI:3132891 from [Arabidopsis thaliana] Length = 516 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 622 FLIFLCDSFSFPRFNSFIITNTHK 551 F FLC+ FS+P +S T+ H+ Sbjct: 22 FFFFLCNGFSYPTTSSLFNTHHHR 45 >At3g26480.1 68416.m03301 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (5 copies, 2 below cutoff); related to LACK protective antigen (GI:13625467) [Leishmania donovani] Length = 764 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 3/66 (4%) Frame = +3 Query: 318 NAVKLERVFAKPFIGCLDGHRDGVSTMAKHPSQLAVLA---SGAFDGEVRIWDLTVRKCT 488 N V + V I L+ H V+++ PS ++ + + DG++RIW+ + K Sbjct: 28 NTVSVYSVATGLKITSLEDHTAPVTSVIVDPSSDETVSYCWTSSLDGKIRIWEFSAPKLL 87 Query: 489 RNFVAH 506 + F H Sbjct: 88 KIFDTH 93 >At3g20740.1 68416.m02624 fertilization-independent endosperm protein (FIE) contains 6 WD-40 repeats (PF00400); identical to fertilization-independent endosperm protein (GI:4567095) [Arabidopsis thaliana] Length = 369 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDL 470 GHR V ++ HPS + AS D ++IW + Sbjct: 172 GHRYEVLSVDFHPSDIYRFASCGMDTTIKIWSM 204 >At3g13300.2 68416.m01675 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1309 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 GH V+ MA + +LAS + DG+V +W ++ Sbjct: 200 GHSQRVTDMAFFAEDVDMLASVSLDGKVFVWKIS 233 >At3g13300.1 68416.m01674 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1344 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 GH V+ MA + +LAS + DG+V +W ++ Sbjct: 235 GHSQRVTDMAFFAEDVDMLASVSLDGKVFVWKIS 268 >At3g13290.1 68416.m01673 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1322 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 372 GHRDGVSTMAKHPSQLAVLASGAFDGEVRIWDLT 473 GH V+ MA + +LAS + DG+V +W ++ Sbjct: 219 GHSQRVTDMAFFAEDVHLLASVSLDGKVFVWKIS 252 >At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP:O43684)[Homo sapiens] Length = 339 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/70 (21%), Positives = 30/70 (42%) Frame = +2 Query: 515 VRALCYNPDGKHFMSVGDDKTIKTWKAEAVTEEDEEPTNTLLSMSVVSGITHHRNKPIFA 694 VR + Y+ ++ DKTIK W + + T + V+ ++ N+ + A Sbjct: 100 VRCVEYSYAAGQVITGSWDKTIKCWDPRGASGTERTQIGTYMQPERVNSLSLVGNRLVVA 159 Query: 695 TCGEQCQLWE 724 T G +++ Sbjct: 160 TAGRHVNIYD 169 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,880,816 Number of Sequences: 28952 Number of extensions: 318372 Number of successful extensions: 1294 Number of sequences better than 10.0: 133 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1290 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -