BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30581 (673 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5K2J7 Cluster: Putative uncharacterized protein; n=1; ... 33 6.3 UniRef50_A3VMV4 Cluster: Putative uncharacterized protein; n=1; ... 33 8.3 >UniRef50_A5K2J7 Cluster: Putative uncharacterized protein; n=1; Plasmodium vivax|Rep: Putative uncharacterized protein - Plasmodium vivax Length = 3000 Score = 33.1 bits (72), Expect = 6.3 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 3/57 (5%) Frame = -2 Query: 378 SSIEQRRLGIVDENVEFAIKTVILQLRNVSLNVNWTL---YIACFAFIGRYLQFLLK 217 SSI++ + E++E + + +ILQ R ++ +V + L Y+ F Y+QF+LK Sbjct: 1004 SSIKEESESHIYESIEESFQKIILQFRKINSSVTFYLYCKYLNTFFLSDAYIQFVLK 1060 >UniRef50_A3VMV4 Cluster: Putative uncharacterized protein; n=1; Rhodobacterales bacterium HTCC2654|Rep: Putative uncharacterized protein - Rhodobacterales bacterium HTCC2654 Length = 147 Score = 32.7 bits (71), Expect = 8.3 Identities = 13/48 (27%), Positives = 27/48 (56%) Frame = -2 Query: 405 NALMDKQTNSSIEQRRLGIVDENVEFAIKTVILQLRNVSLNVNWTLYI 262 + ++DK ++++ + RLG+VD + A+KT + + N N L + Sbjct: 17 SVMLDKSLDTTVRELRLGLVDTQTQGALKTTLCNRAPIISNCNSNLLV 64 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 610,288,298 Number of Sequences: 1657284 Number of extensions: 11352121 Number of successful extensions: 21706 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21702 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51652897375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -