BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30581 (673 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 24 0.99 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 22 4.0 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 22 5.3 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 9.2 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 24.2 bits (50), Expect = 0.99 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 481 YPIL*TEWYKLTSP*IRHYGSSRSFNGAFRY 573 +P+ EW K+ ++HY S+ + RY Sbjct: 116 WPLFLNEWTKIEINLLKHYQSTTDLHKKIRY 146 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 357 LGIVDENVEFAIKTVILQLRNVSLNVNW 274 LGI+D V F I + ++ S N+N+ Sbjct: 333 LGILDAIVTFLIVMIQFEMTQNSTNINF 360 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 21.8 bits (44), Expect = 5.3 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 357 LGIVDENVEFAIKTVILQLRNVSLNVN 277 LGI+D V F I + ++ S N+N Sbjct: 333 LGILDAIVTFLIVMIQFEMTQNSTNIN 359 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.0 bits (42), Expect = 9.2 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -3 Query: 581 CLWYLKAPLKDRED 540 C WY+ L+ R+D Sbjct: 460 CFWYVPKSLRGRKD 473 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,330 Number of Sequences: 336 Number of extensions: 3092 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -