BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30581 (673 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42839-9|AAC69013.3| 355|Caenorhabditis elegans Ligand-gated io... 32 0.32 U23525-7|AAC46569.1| 557|Caenorhabditis elegans Yeast smf (diva... 28 6.9 >U42839-9|AAC69013.3| 355|Caenorhabditis elegans Ligand-gated ion channel protein 3 protein. Length = 355 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 303 LRNVSLNVNWTLYIACFAFIGRYLQFL 223 L+N S N W L ++C+ GR+L FL Sbjct: 228 LKNYSPNEEWALQVSCYKGFGRFLNFL 254 >U23525-7|AAC46569.1| 557|Caenorhabditis elegans Yeast smf (divalent cation transporter)homolog protein 1, isoform a protein. Length = 557 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = -1 Query: 352 NRGRKR*ICN*NSYFTITQCIVKCKLDALHCMFRFYRALPSVFVKARYQRFRSDSLAPCI 173 +R +R + N YFT+ I AL F + +VF YQ+ +D CI Sbjct: 268 DRKDRRRVAEANKYFTLESAI------ALFLSFFINLFVVAVFAHGLYQKTNADVREMCI 321 Query: 172 TRH 164 RH Sbjct: 322 ARH 324 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,207,853 Number of Sequences: 27780 Number of extensions: 280377 Number of successful extensions: 527 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -