BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30578 (312 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ535443-1|ABF83386.1| 129|Homo sapiens circulating B cell anti... 27 8.8 BC000884-1|AAH00884.1| 104|Homo sapiens signal peptidase comple... 27 8.8 >DQ535443-1|ABF83386.1| 129|Homo sapiens circulating B cell antibody heavy chain variable region protein. Length = 129 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -3 Query: 172 VVITKQSSVKSALYLAALLPPRIVSYIWGCSTSLLSWVCSATVAGVPSWSPSLW 11 V IT+ +S +A + L + ++ C+ + WV AT +G P+W LW Sbjct: 70 VTITRDTSASTAYMELSSLRSEDTA-VYYCARA--GWVVGATKSGRPNWYFDLW 120 >BC000884-1|AAH00884.1| 104|Homo sapiens signal peptidase complex subunit 1 homolog (S. cerevisiae) protein. Length = 104 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 96 IFGGAALACYPGFARRPWPVYRR 28 + G A +C PWP+YRR Sbjct: 52 VMAGFAFSCLAQLTLPPWPIYRR 74 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,336,720 Number of Sequences: 237096 Number of extensions: 734509 Number of successful extensions: 1763 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1763 length of database: 76,859,062 effective HSP length: 78 effective length of database: 58,365,574 effective search space used: 1459139350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -