BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30578 (312 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61240.2 68414.m06901 expressed protein contains Pfam profile... 28 1.1 At1g61240.1 68414.m06900 expressed protein contains Pfam profile... 28 1.1 At1g76630.1 68414.m08916 tetratricopeptide repeat (TPR)-containi... 27 2.0 At5g01460.1 68418.m00059 LMBR1 integral membrane family protein ... 27 3.5 At3g08930.2 68416.m01039 LMBR1 integral membrane family protein ... 27 3.5 At3g08930.1 68416.m01040 LMBR1 integral membrane family protein ... 27 3.5 At3g17400.1 68416.m02223 F-box family protein contains Pfam prof... 26 4.6 At2g13650.2 68415.m01505 GDP-mannose transporter (GONST1) identi... 26 6.1 At2g13650.1 68415.m01504 GDP-mannose transporter (GONST1) identi... 26 6.1 At1g44010.1 68414.m05077 hypothetical protein 26 6.1 At5g62480.1 68418.m07841 glutathione S-transferase, putative 25 8.1 At5g55135.1 68418.m06874 hypothetical protein 25 8.1 At2g19980.1 68415.m02336 allergen V5/Tpx-1-related family protei... 25 8.1 At2g03350.1 68415.m00294 expressed protein contains Pfam profile... 25 8.1 >At1g61240.2 68414.m06901 expressed protein contains Pfam profile PF05212: Protein of unknown function (DUF707) Length = 425 Score = 28.3 bits (60), Expect = 1.1 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 111 GGSSAAKYSALLTLLCFVITTKILK*IFWYLTKNVQ 218 GG S+ K ++ L+C V+ IFWY T N+Q Sbjct: 24 GGKSSWKMKPVVVLMCTVLL------IFWYKTTNIQ 53 >At1g61240.1 68414.m06900 expressed protein contains Pfam profile PF05212: Protein of unknown function (DUF707) Length = 425 Score = 28.3 bits (60), Expect = 1.1 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 111 GGSSAAKYSALLTLLCFVITTKILK*IFWYLTKNVQ 218 GG S+ K ++ L+C V+ IFWY T N+Q Sbjct: 24 GGKSSWKMKPVVVLMCTVLL------IFWYKTTNIQ 53 >At1g76630.1 68414.m08916 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile: PF00515 TPR Domain (5 copies) Length = 1064 Score = 27.5 bits (58), Expect = 2.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 127 AALLPPRIVSYIWGCSTSLLSWVCSATVAGVPSWSPSL 14 A + P+ +S ++G ++ LLSW G W+ SL Sbjct: 218 ALKISPQNISVLYGLASGLLSWSKECINLGAFGWAASL 255 >At5g01460.1 68418.m00059 LMBR1 integral membrane family protein contains Pfam PF04791: LMBR1-like conserved region Length = 509 Score = 26.6 bits (56), Expect = 3.5 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = -1 Query: 108 VSFRIFGGAALACYP-----GFARRPWPVYRR 28 V F IFGG +AC P F RRP V R Sbjct: 218 VLFTIFGGVGIACLPLGLITAFIRRPKAVITR 249 >At3g08930.2 68416.m01039 LMBR1 integral membrane family protein contains 5 transmembrane domains; contains Pfam PF04791: LMBR1-like conserved region; similar to unknown protein GB:BAA83351 [Oryza sativa] Length = 526 Score = 26.6 bits (56), Expect = 3.5 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = -1 Query: 108 VSFRIFGGAALACYP-----GFARRPWPVYRR 28 V F IFGG +AC P F RRP V R Sbjct: 235 VLFTIFGGVGIACLPLGLITAFIRRPKAVITR 266 >At3g08930.1 68416.m01040 LMBR1 integral membrane family protein contains 5 transmembrane domains; contains Pfam PF04791: LMBR1-like conserved region; similar to unknown protein GB:BAA83351 [Oryza sativa] Length = 310 Score = 26.6 bits (56), Expect = 3.5 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = -1 Query: 108 VSFRIFGGAALACYP-----GFARRPWPVYRR 28 V F IFGG +AC P F RRP V R Sbjct: 19 VLFTIFGGVGIACLPLGLITAFIRRPKAVITR 50 >At3g17400.1 68416.m02223 F-box family protein contains Pfam profile: PF00646 F-box domain Length = 185 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -3 Query: 103 VSYIWGCSTSLLSWV--CSATVAGVPSWSPSLWF 8 +SY++ C + +L C+ V P W +LWF Sbjct: 101 ISYVYHCDSLVLCIPKDCARLVVWNPYWGQTLWF 134 >At2g13650.2 68415.m01505 GDP-mannose transporter (GONST1) identical to GDP-mannose transporter SP:Q941R4 from [Arabidopsis thaliana] Length = 284 Score = 25.8 bits (54), Expect = 6.1 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -3 Query: 277 LIVKFILYSHKFNAKLLIFS*TFLVKYQNIYFRIFVV 167 L+ KF+L S+ FNA + FL+ YQN I VV Sbjct: 49 LVNKFVLSSYNFNAGI------FLMLYQNFVSVIIVV 79 >At2g13650.1 68415.m01504 GDP-mannose transporter (GONST1) identical to GDP-mannose transporter SP:Q941R4 from [Arabidopsis thaliana] Length = 333 Score = 25.8 bits (54), Expect = 6.1 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -3 Query: 277 LIVKFILYSHKFNAKLLIFS*TFLVKYQNIYFRIFVV 167 L+ KF+L S+ FNA + FL+ YQN I VV Sbjct: 49 LVNKFVLSSYNFNAGI------FLMLYQNFVSVIIVV 79 >At1g44010.1 68414.m05077 hypothetical protein Length = 227 Score = 25.8 bits (54), Expect = 6.1 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +3 Query: 201 LTKNVQLKINSLALNLCEYNINLTIN*NS 287 LTKN +KI+ + + E+N+N+TI +S Sbjct: 6 LTKNKHIKIHGDSSSNDEHNVNITITNDS 34 >At5g62480.1 68418.m07841 glutathione S-transferase, putative Length = 240 Score = 25.4 bits (53), Expect = 8.1 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 152 TLLRYNHKDSKINILVFN*KRSTEN 226 TLLRYN KI +LV N K +E+ Sbjct: 47 TLLRYNPVHKKIPVLVHNGKPISES 71 >At5g55135.1 68418.m06874 hypothetical protein Length = 112 Score = 25.4 bits (53), Expect = 8.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 43 PRSPSKPRITS*CCTPKYTKRYAAA 117 P+S SKP IT+ C Y KR +A+ Sbjct: 8 PKSISKPNITTSCIYSFYLKRGSAS 32 >At2g19980.1 68415.m02336 allergen V5/Tpx-1-related family protein low similarity to SP|P33154 Pathogenesis-related protein 1 precursor (PR-1) {Arabidopsis thaliana}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 165 Score = 25.4 bits (53), Expect = 8.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 66 DNKLVLHPQIYETIRGGSSAAKYS 137 D KL H Q Y +R A KYS Sbjct: 49 DQKLAAHAQRYANVRSQDCAMKYS 72 >At2g03350.1 68415.m00294 expressed protein contains Pfam profile PF04398: Protein of unknown function, DUF538 Length = 179 Score = 25.4 bits (53), Expect = 8.1 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = -3 Query: 154 SSVKSALYLAALLPPRIVSYIWGCSTSLLSWVCSATVAGVPSWSPSLWF 8 S+++ A + +L + + G T +L WV T++ S S LWF Sbjct: 105 SAIRYATRVKGILLRGKLMGVEGMKTKVLVWVKVTTISVESSKSDKLWF 153 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,975,958 Number of Sequences: 28952 Number of extensions: 101670 Number of successful extensions: 292 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 331449360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -