BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30575 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 76 1e-15 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 25 3.4 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 25 3.4 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 5.9 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 5.9 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 5.9 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 75.8 bits (178), Expect = 1e-15 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 255 EPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDG 377 EPTAAA+AYGLDK GERNVLIFDLGGGTFDVSILTI++G Sbjct: 35 EPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEG 75 Score = 51.6 bits (118), Expect = 3e-08 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 154 NAVITVPAYFNDSQRQATKDAGTISG 231 +AVITVPAYFNDSQRQATKDAG I+G Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAG 26 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 3.4 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -3 Query: 412 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 314 W+ P T+ +P++ PPP + +T Sbjct: 221 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 253 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.4 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -3 Query: 412 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 314 W+ P T+ +P++ PPP + +T Sbjct: 222 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 254 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 5.9 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -3 Query: 412 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 314 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDQPPPPPTTTTTT 254 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 5.9 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -3 Query: 412 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 314 W+ P T+ +P + PPP + +T Sbjct: 222 WIDPTATTTTHVPPTTTTWSDLPPPPPTTTTTT 254 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 452 LCPGVQEEIQKGPRYQQESLRRL 520 L PG+QE I + R QQE+ R+ Sbjct: 2077 LSPGLQEVIDRFVRIQQENGHRI 2099 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 851,438 Number of Sequences: 2352 Number of extensions: 18383 Number of successful extensions: 63 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -