BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30574 (755 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 27 2.9 SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter family|Sch... 27 3.8 SPAC56F8.06c |alg10||dolichyl-phosphate-glucose-glycolipid alpha... 26 6.7 >SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 230 Score = 27.1 bits (57), Expect = 2.9 Identities = 31/106 (29%), Positives = 44/106 (41%), Gaps = 4/106 (3%) Frame = +3 Query: 384 FSKPFYGTE---FRCLLCSYYDYIFLLQIERNYPFR*LSSSLIFSTRSPKHDEQARAFSF 554 F PF G+E FRCLL ++ +F L ++ F S + S F F Sbjct: 101 FLHPFTGSELSLFRCLLLFFFFLLFFLSFSFSFSFLFFLSQIFIVYFSSFPILHFLFFFF 160 Query: 555 VNNAPNSTH*CFCCFRS-LFYFFHNIILPLVYNEAIYVVHNFSTLS 689 + C C F S LF H + L +++ + V FSTLS Sbjct: 161 L---------CVCVFLSFLFSLSHLLSLAILFLPLLLRV--FSTLS 195 >SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter family|Schizosaccharomyces pombe|chr 3|||Manual Length = 791 Score = 26.6 bits (56), Expect = 3.8 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +3 Query: 591 CCFRSLFYFFHNIILPLVYNEAIYVVHNFSTLSFEYYT 704 CC + F F+ I+LP +Y + + V +F ++ YT Sbjct: 349 CCIFTSFVFWIWIVLPGLYYQNYWQVAHFPIMTNSIYT 386 >SPAC56F8.06c |alg10||dolichyl-phosphate-glucose-glycolipid alpha-glucosyltransferase Alg10|Schizosaccharomyces pombe|chr 1|||Manual Length = 445 Score = 25.8 bits (54), Expect = 6.7 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 4/71 (5%) Frame = +3 Query: 279 QLPIIFCFFFHLKPSSFIIRRKL-HSEPLKCISSLKFSKPFYGTEFRCLLCSYYDYI--- 446 Q+ FFF S+II+ + HS K +S++ FSK + LL ++++ I Sbjct: 258 QINYFLWFFFFFSFPSYIIKYLMSHSRRSKLLSAV-FSKKSFLIVSVLLLIAHFNTIFHP 316 Query: 447 FLLQIERNYPF 479 F+L R+Y F Sbjct: 317 FILADNRHYLF 327 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,864,453 Number of Sequences: 5004 Number of extensions: 58975 Number of successful extensions: 172 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 171 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -