BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30573 (769 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33090.1 68417.m04715 aminopeptidase M similar to SP|Q11011 P... 74 1e-13 At5g13520.1 68418.m01561 peptidase M1 family protein similar to ... 44 8e-05 At1g63770.2 68414.m07216 peptidase M1 family protein similar to ... 39 0.003 At1g63770.1 68414.m07217 peptidase M1 family protein similar to ... 39 0.003 At5g35753.1 68418.m04282 expressed protein 29 2.6 At5g19840.1 68418.m02357 transcription factor jumonji (jmjC) dom... 29 2.6 At2g40920.1 68415.m05050 F-box family protein contains Pfam PF00... 29 4.5 At1g73960.1 68414.m08565 expressed protein similar to TATA bindi... 29 4.5 >At4g33090.1 68417.m04715 aminopeptidase M similar to SP|Q11011 Puromycin-sensitive aminopeptidase (EC 3.4.11.-) (PSA) {Mus musculus}; contains Pfam profile PF01433: Peptidase family M1 Length = 879 Score = 73.7 bits (173), Expect = 1e-13 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +2 Query: 650 VCGHELAHQWFGNLVTMRWWTDLWLNEGFASYIEYL 757 V HELAHQWFGNLVTM WWT LWLNEGFA+++ YL Sbjct: 304 VVAHELAHQWFGNLVTMEWWTHLWLNEGFATWVSYL 339 >At5g13520.1 68418.m01561 peptidase M1 family protein similar to SP|P09960 Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) {Homo sapiens}; contains Pfam profile PF01433: Peptidase family M1 Length = 616 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/34 (55%), Positives = 21/34 (61%) Frame = +2 Query: 650 VCGHELAHQWFGNLVTMRWWTDLWLNEGFASYIE 751 V HELAH W GNL+T WLNEGF +Y E Sbjct: 306 VVAHELAHSWTGNLITNINNEHFWLNEGFTTYAE 339 >At1g63770.2 68414.m07216 peptidase M1 family protein similar to SP|P04825 Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoacylpeptide hydrolase) {Escherichia coli}; contains Pfam profile PF01433: Peptidase family M1 Length = 945 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +2 Query: 647 GVCGHELAHQWFGNLVTMRWWTDLWLNEGFASY 745 GV GHE H W GN VT R W L L EG + Sbjct: 389 GVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVF 421 >At1g63770.1 68414.m07217 peptidase M1 family protein similar to SP|P04825 Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoacylpeptide hydrolase) {Escherichia coli}; contains Pfam profile PF01433: Peptidase family M1 Length = 918 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +2 Query: 647 GVCGHELAHQWFGNLVTMRWWTDLWLNEGFASY 745 GV GHE H W GN VT R W L L EG + Sbjct: 389 GVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVF 421 >At5g35753.1 68418.m04282 expressed protein Length = 592 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +3 Query: 522 PVRTPNRSYHQY--TMLVHNVRAREISLLYDEVEGIPR 629 P+ P+ +H + L AR+I +YDE +G+PR Sbjct: 358 PITVPDSDFHDFDKNRLEECFEARQIWAIYDEDDGMPR 395 >At5g19840.1 68418.m02357 transcription factor jumonji (jmjC) domain-containing protein low similarity to PASS1 [Homo sapiens] GI:21591407; contains Pfam profile PF02373: jmjC domain Length = 505 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = +1 Query: 13 HDPHHSSLLVIYVTIILLSWPPLTT---YPTQARGQSRHH 123 +DPHH+ L V+ ++ WPP + YP G++ +H Sbjct: 185 YDPHHNLLCVVSGRKKVVLWPPSASPSLYPMPIYGEASNH 224 >At2g40920.1 68415.m05050 F-box family protein contains Pfam PF00646: F-box domain; similar to F-box protein family, AtFBX8 (GP:20197464) {Arabidopsis thaliana}|502017|gb|T20576.1|T20576 Length = 436 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = +1 Query: 61 LLSWPPLTTYPTQARGQSRHHPKHVISGSLDPLSMLFSVLIKIIMSLCL 207 LL+ P + + +GQ++HHP++ I DP+S + ++ + +S L Sbjct: 173 LLTLPAIKSDIVAQQGQTKHHPRYYIGH--DPVSDQYKLVCTVAISSLL 219 >At1g73960.1 68414.m08565 expressed protein similar to TATA binding protein associated factor (GI:2827282) [Homo sapiens]; similar to Transcription initiation factor TFIID 150 kDa subunit (TAFII-150) (TAFII150) (Swiss-Prot:Q24325) [Drosophila melanogaster] Length = 1390 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 665 LAHQWFGNLVTMRWWTDLWLNEGFASYI 748 LA QWFG +T D WL +G A ++ Sbjct: 355 LAKQWFGVYITPESPNDDWLLDGLAGFL 382 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,594,516 Number of Sequences: 28952 Number of extensions: 387709 Number of successful extensions: 888 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 888 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -