BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30571 (769 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 5.5 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 5.5 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 9.5 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 9.5 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 21 9.5 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 9.5 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 9.5 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 474 ADCPSRAACLSSDALTLAR 530 + CP A+ LSS TLAR Sbjct: 690 SQCPQTASLLSSTHSTLAR 708 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 11 VKDHRPICSCRNGYEGDPYRTCRVVG 88 VK+ P C+ N + R C +VG Sbjct: 149 VKNFHPRCAVNNYNDPSNVRNCELVG 174 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.4 bits (43), Expect = 9.5 Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 11/60 (18%) Frame = +2 Query: 614 GFVSNGGGICRPVIEFFESTC-----------EIDSNCTSNHACISSVCKNPSDCGPNTD 760 G V+N +C P + F+ T ++ N T+ +SS+ DC N+D Sbjct: 141 GLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSD 200 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 299 ISNVKLTDVLILASLTIY 352 + N+KLTD LI A ++ Sbjct: 284 LENIKLTDSLIAAQAFVF 301 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.4 bits (43), Expect = 9.5 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +2 Query: 485 VKSSLFVFRCVNPC 526 ++ LF+F C N C Sbjct: 297 IQKGLFLFACTNSC 310 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 9.5 Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 11/60 (18%) Frame = +2 Query: 614 GFVSNGGGICRPVIEFFESTC-----------EIDSNCTSNHACISSVCKNPSDCGPNTD 760 G V+N +C P + F+ T ++ N T+ +SS+ DC N+D Sbjct: 141 GLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSD 200 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 9.5 Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 11/60 (18%) Frame = +2 Query: 614 GFVSNGGGICRPVIEFFESTC-----------EIDSNCTSNHACISSVCKNPSDCGPNTD 760 G V+N +C P + F+ T ++ N T+ +SS+ DC N+D Sbjct: 141 GLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSD 200 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 231,304 Number of Sequences: 438 Number of extensions: 5268 Number of successful extensions: 16 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -