BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30562X (492 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48570.1 68414.m05431 zinc finger (Ran-binding) family protei... 29 2.2 At5g49780.1 68418.m06165 leucine-rich repeat transmembrane prote... 28 3.9 >At1g48570.1 68414.m05431 zinc finger (Ran-binding) family protein contains Pfam domain, PF00641: Zn-finger in Ran binding protein and others Length = 455 Score = 28.7 bits (61), Expect = 2.2 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -2 Query: 335 MHFTLREICNKNKAKNSSRNTVGNVVETKK 246 ++FT + C K KAK + ++ N+VE KK Sbjct: 348 LNFTRNQSCLKCKAKGPKKTSMVNIVEMKK 377 >At5g49780.1 68418.m06165 leucine-rich repeat transmembrane protein kinase, putative Length = 1006 Score = 27.9 bits (59), Expect = 3.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 178 SCVTLCCKCVKKQQSNFLQYNNYC*N 101 SC+T+ CKC +++ FL Y+ C N Sbjct: 22 SCLTILCKCFVSEEAVFL-YSRLCHN 46 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,461,200 Number of Sequences: 28952 Number of extensions: 167752 Number of successful extensions: 424 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 858708096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -