BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30561X (508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.059 SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) 33 0.14 SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) 33 0.18 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 32 0.24 SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) 32 0.24 SB_8559| Best HMM Match : Dpy-30 (HMM E-Value=3.7e-11) 32 0.24 SB_38777| Best HMM Match : Mov34 (HMM E-Value=1.6e-19) 31 0.41 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_21397| Best HMM Match : Tropomodulin (HMM E-Value=0) 31 0.72 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 31 0.72 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 31 0.72 SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_58769| Best HMM Match : XPA_C (HMM E-Value=0.01) 30 0.95 SB_53103| Best HMM Match : DUF1388 (HMM E-Value=0.29) 30 0.95 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 30 0.95 SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) 30 0.95 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_22299| Best HMM Match : Protamine_P2 (HMM E-Value=2.4) 30 1.3 SB_58858| Best HMM Match : zf-CXXC (HMM E-Value=7.2) 29 1.7 SB_34623| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 29 2.9 SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) 29 2.9 SB_20947| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_18529| Best HMM Match : DUF1388 (HMM E-Value=3.5) 29 2.9 SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) 29 2.9 SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_38149| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43) 28 5.1 SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) 28 5.1 SB_45707| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_33649| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_25419| Best HMM Match : PH (HMM E-Value=2.8e-16) 28 5.1 SB_37598| Best HMM Match : TrbF (HMM E-Value=0.3) 27 6.7 SB_3385| Best HMM Match : 3_5_exonuc (HMM E-Value=0.0015) 27 6.7 SB_52343| Best HMM Match : OTU (HMM E-Value=0.0036) 27 6.7 SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) 27 6.7 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 27 6.7 SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_33387| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 27 8.9 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 27 8.9 SB_16859| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) 27 8.9 SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_540| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_53672| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_39563| Best HMM Match : Ctr (HMM E-Value=0.39) 27 8.9 SB_32735| Best HMM Match : DUF465 (HMM E-Value=1.7) 27 8.9 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 27 8.9 SB_19503| Best HMM Match : Kinesin (HMM E-Value=9.5e-14) 27 8.9 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 34.3 bits (75), Expect = 0.059 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = +1 Query: 79 IEEKRQRLEEAEKKRQAMLQAMKDA 153 +EE+R+RLE EK+RQA QAM++A Sbjct: 319 LEEERKRLENLEKERQAAQQAMQEA 343 >SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) Length = 2565 Score = 33.1 bits (72), Expect = 0.14 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 350 VHRQTRDREIRSRREAKETGLRLKRARRKTKQQLRHKALKK 472 + RQ R + R RR + + R +R RR+ + QLR K +K Sbjct: 681 IRRQRRRKRRRKRRRQRRSRRRRRRRRRRRRSQLRRKRRRK 721 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 356 RQTRDREIRSRREAKETGLRLKRARRKTKQQLRHKALKK 472 R+ R R R RR+ + R +R RRK +++ R A +K Sbjct: 487 RRRRRRRRRRRRQRRRRRRRRRRNRRKRRRRKRRTARRK 525 >SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) Length = 1168 Score = 32.7 bits (71), Expect = 0.18 Identities = 16/60 (26%), Positives = 35/60 (58%) Frame = +1 Query: 76 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEE 255 ++EEK++RL+ E+ + ++ +A K+ASK+ + T + +S N ++ K ++E Sbjct: 427 EVEEKKRRLQRYERLQSSLNEAYKEASKSSVDGT-RDESRNEEITQTSCNETSGKTPIKE 485 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 32.3 bits (70), Expect = 0.24 Identities = 21/59 (35%), Positives = 33/59 (55%) Frame = +1 Query: 79 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEE 255 +EE+R+R EEAEKKR+ + ++ + + KK E L QLER K +++ E Sbjct: 252 MEEERKRKEEAEKKREEEERKRREEEEAAQKW---KKEEL--LRQQQLEREKEEQERAE 305 >SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) Length = 787 Score = 32.3 bits (70), Expect = 0.24 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +1 Query: 82 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEE 255 + ++ L + EKK Q ML+ K A+K P F ++ +EN G A+ N +++LEE Sbjct: 607 QRNKEALAKKEKKIQEMLEEEKKATKFEP-FNLE--TENRGSVKAEKWLNSVQQELEE 661 >SB_8559| Best HMM Match : Dpy-30 (HMM E-Value=3.7e-11) Length = 806 Score = 32.3 bits (70), Expect = 0.24 Identities = 17/46 (36%), Positives = 30/46 (65%) Frame = +2 Query: 335 PGTLGVHRQTRDREIRSRREAKETGLRLKRARRKTKQQLRHKALKK 472 PG + ++ ++RE R RREA+E L RA+R+ + ++R + +KK Sbjct: 599 PGLNWLEKERKEREERERREAEEAAL---RAQREEEWRVRLQEVKK 641 >SB_38777| Best HMM Match : Mov34 (HMM E-Value=1.6e-19) Length = 431 Score = 31.5 bits (68), Expect = 0.41 Identities = 15/43 (34%), Positives = 30/43 (69%) Frame = +3 Query: 318 KLRQKAQELWECIVKLETEKYDLEERQKRQDYDLKELEERQSS 446 +++QK +E E ++K E E+ +ER++ + ++ELEER++S Sbjct: 121 EIKQKQKEQEE-LIKKEQERIKEQERKRAEQQLVRELEERENS 162 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.1 bits (67), Expect = 0.55 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Frame = +2 Query: 170 TSPSKRRAKTSV*AMPSWS--ATRPR--SSWKREEDLPVHPHQAA 292 TS +RR + ++ P WS A PR S W+RE+ + +PH+A+ Sbjct: 7 TSGQRRREENAITKTP-WSLHAKSPRGHSPWRREDSINANPHEAS 50 >SB_21397| Best HMM Match : Tropomodulin (HMM E-Value=0) Length = 373 Score = 30.7 bits (66), Expect = 0.72 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = +2 Query: 251 KREEDLPVHPHQAADHRGSLRRQTPTEGPGTLGVHRQ-TRDREIRSRREAKETGLRLKRA 427 KR++ +P+ P +D + + E G LG+H T ++ ++ REA + L+ Sbjct: 100 KRDDPVPMLPDDLSDVLENATEEQLLELAGVLGIHSMLTSEQSHQAEREASDRFLKGSGL 159 Query: 428 RRKTKQQLRHKALKK 472 ++ T ++ LKK Sbjct: 160 KKYTPGIVKGTKLKK 174 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 30.7 bits (66), Expect = 0.72 Identities = 16/39 (41%), Positives = 26/39 (66%) Frame = +1 Query: 82 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSEN 198 EE+RQ+ EEA K+R+ L A K++SK+ +++S N Sbjct: 1344 EERRQKREEARKRREEKL-AKKESSKSSNKRKSKERSGN 1381 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 30.7 bits (66), Expect = 0.72 Identities = 21/71 (29%), Positives = 29/71 (40%) Frame = +2 Query: 224 SATRPRSSWKREEDLPVHPHQAADHRGSLRRQTPTEGPGTLGVHRQTRDREIRSRREAKE 403 SA+ PRS KREE+ P ++ R P G + + R R RRE Sbjct: 287 SASAPRSRGKREENSVSPPRRSKGRREENSVSPPRRSKGRREDNSVSPPRGNRGRREKNS 346 Query: 404 TGLRLKRARRK 436 +R RR+ Sbjct: 347 ASPSRRRGRRE 357 >SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2391 Score = 30.7 bits (66), Expect = 0.72 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +3 Query: 132 APGHE--RCQQDRTQLHHPKEERKLRFEQ 212 APGH+ RC QD +L+ K ERK R EQ Sbjct: 1105 APGHQPLRCLQDVEELYLSKVERKDRLEQ 1133 >SB_58769| Best HMM Match : XPA_C (HMM E-Value=0.01) Length = 123 Score = 30.3 bits (65), Expect = 0.95 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +3 Query: 288 PLTIEGLSVDKLRQKAQELWECIVKLETEKYDLEERQKRQDYDLKELEERQ 440 P+ I LS +++ KA E+W + KLE EK + +QK+ + + K EE++ Sbjct: 54 PMKIFKLS--EVKSKAVEVWGSLEKLEDEK--TKRKQKKVNVETKNEEEKR 100 >SB_53103| Best HMM Match : DUF1388 (HMM E-Value=0.29) Length = 462 Score = 30.3 bits (65), Expect = 0.95 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 1/92 (1%) Frame = +2 Query: 176 PSKRRAKTSV*AMPSWSATRPRSSWKR-EEDLPVHPHQAADHRGSLRRQTPTEGPGTLGV 352 PS R + S A P A R++ KR +E P + H+ R +TP EG Sbjct: 23 PSPFRPEISE-AEPDKGAACYRANTKRRQEQKPPEEGKNKKHQKKARTETPEEGK----- 76 Query: 353 HRQTRDREIRSRREAKETGLRLKRARRKTKQQ 448 +R TR R+ + E + KRAR +T ++ Sbjct: 77 NRNTRRRQEQKLPEEGKNKKHQKRARTETTRR 108 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 30.3 bits (65), Expect = 0.95 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +2 Query: 215 PSWSATRPRSSWKREEDLPVHP-HQAADHRG-SLRRQTPTEGPGTLG 349 P AT+P+S +++ HP HQ H G SL Q P GPG LG Sbjct: 191 PPEHATQPQSLPDQQQQQ--HPGHQQQQHPGQSLLGQQPQSGPGQLG 235 >SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) Length = 1491 Score = 30.3 bits (65), Expect = 0.95 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 4/60 (6%) Frame = +3 Query: 315 DKLRQKAQE----LWECIVKLETEKYDLEERQKRQDYDLKELEERQSSN*GTKLSRRVST 482 DKL Q ++ L E KLETEK +L+ER + + +E++ER + L+ +V++ Sbjct: 908 DKLEQTSKRYEALLDELTAKLETEKMELQERLTKNN---EEMQERMKTEFAEHLASKVAS 964 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 30.3 bits (65), Expect = 0.95 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 326 SEFVDGETLDGQRLDADGQGD 264 S+ VDG+ +DG +D DG GD Sbjct: 607 SDSVDGDNVDGDSVDGDGDGD 627 >SB_22299| Best HMM Match : Protamine_P2 (HMM E-Value=2.4) Length = 488 Score = 29.9 bits (64), Expect = 1.3 Identities = 21/103 (20%), Positives = 45/103 (43%), Gaps = 1/103 (0%) Frame = +2 Query: 140 P*KMPARPDPTSPSKRRAKTSV*AMPSWSATRPRSSWKREEDLPVHPHQAA-DHRGSLRR 316 P K ARP + R+ KTS + P + + +++ P QA+ + S Sbjct: 112 PKKQAARPREARKASRKTKTSKKSKPQDQDKQDKQDQDKQDKQAARPRQASCKTKTSKLH 171 Query: 317 QTPTEGPGTLGVHRQTRDREIRSRREAKETGLRLKRARRKTKQ 445 + R+T+ + + +++ + T R ++ARR +++ Sbjct: 172 DQDKQAARPRQASRKTKTSKPQDKQDKQATRPRPRQARRASRK 214 >SB_58858| Best HMM Match : zf-CXXC (HMM E-Value=7.2) Length = 168 Score = 29.5 bits (63), Expect = 1.7 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +2 Query: 365 RDREIRSRREAKETGLRLKRARRKTKQQLRHK-ALKKGLDPEALTGK 502 R RE++ R+ ++ RLK R TK + RH+ A +KG +GK Sbjct: 38 RAREVKLTRKERKISRRLKLTRWDTKMERRHRGAEEKGTQGGVGSGK 84 >SB_34623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 553 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 342 LWECIVKLETEKYDLEERQKRQDYDLKE 425 L +C+ KL+TEK LE+R + DLK+ Sbjct: 105 LADCLAKLKTEKNSLEQRLSCIEQDLKQ 132 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/59 (25%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +1 Query: 82 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKK-SENFGLSNAQLERNKTKEQLEE 255 EE+R++ EEAE++R+ + K + +QK+ E Q + + K+++ E Sbjct: 636 EERRRQQEEAERQRREQEEVFKQQEQQRQQLELQKRQQEQQRQQELQKRQQEEKQRMAE 694 >SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) Length = 865 Score = 28.7 bits (61), Expect = 2.9 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +2 Query: 233 RPRSSWK-REEDLPVHPHQAADHRGSLRRQTPTEGPGTLGVHRQTRDREIRSRREAKETG 409 + RS K +E+ P ++ H S R+ + + +RDR+ +SRR ++ Sbjct: 258 KERSKSKDQEKSTPRERRNSSSHHRSSSREKDRKSSMDKSIRSSSRDRDKKSRRSWSKSK 317 Query: 410 LRLKRARRKT 439 R + R KT Sbjct: 318 ERDSKLREKT 327 >SB_20947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 28.7 bits (61), Expect = 2.9 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 299 RGSLRRQTPTEGPGTLGVHRQTRDRE-IRSRREAKETGLRLKRARRKT 439 RG+L +Q T+ L +H QTR ++ + S R + + + RRKT Sbjct: 15 RGALAKQNFTDADYALKLHNQTRPKQSLESMRAPELSDYYIPAKRRKT 62 >SB_18529| Best HMM Match : DUF1388 (HMM E-Value=3.5) Length = 435 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +2 Query: 155 ARPDPTSPSKRRAKTSV*AMPSWSATRPRSSWKR 256 ARP P+ +K KT MP S P+SSW R Sbjct: 290 ARPRPSCKTKPSPKTKT--MPPRSRLEPQSSWNR 321 >SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) Length = 729 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 76 DIEEKRQRLEEAEKKRQAMLQAMKD 150 D+EEK + LEEA+ + +A+ MKD Sbjct: 522 DLEEKAKELEEAKSENEAISGKMKD 546 >SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/57 (24%), Positives = 29/57 (50%) Frame = +1 Query: 82 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLE 252 EEKR EEA K+++++ + + + K T +K+ E ++ N+ ++ E Sbjct: 459 EEKRTESEEAPKRKKSLKRRLSFSRKNKAKKTEEKQDEEGEAREGTMDDNEVSQKPE 515 >SB_38149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 5.1 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 375 KYDLEERQKRQDYDLKELEERQSSN*GTKLSRRVSTPKRSQAST 506 KYD E RQ + + ++ SS+ + V TPK S+ ST Sbjct: 9 KYDHESRQSNTENIVDTVKSSSSSSSSDNQAVTVDTPKHSKKST 52 >SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43) Length = 443 Score = 27.9 bits (59), Expect = 5.1 Identities = 19/87 (21%), Positives = 40/87 (45%) Frame = +3 Query: 144 ERCQQDRTQLHHPKEERKLRFEQCPXXXXXXXXXXXREKKISLSIRIKPLTIEGLSVDKL 323 +R ++++ + H KE + CP +++++ R++ ++ + K Sbjct: 334 QRMREEQETVRHFKERYEEFPCPCPEPSARSRPKRSQKRRVQKIWRLRAGVLQAAEMKKK 393 Query: 324 RQKAQELWECIVKLETEKYDLEERQKR 404 RQKAQ L E K++ EK R+ + Sbjct: 394 RQKAQSLAE-RKKIKKEKKKSNPRRSK 419 >SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) Length = 1078 Score = 27.9 bits (59), Expect = 5.1 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +1 Query: 82 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNA-QLERNKTKEQLEE 255 EE+RQ+ EEA K+R+ L + T + ++K G S A + +K E +E Sbjct: 537 EERRQKREEARKRREEKLAKKGPTTSTSSSRKRRRKFNRNGRSAAIKAAASKLSENEDE 595 >SB_45707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 27.9 bits (59), Expect = 5.1 Identities = 25/108 (23%), Positives = 41/108 (37%) Frame = +2 Query: 146 KMPARPDPTSPSKRRAKTSV*AMPSWSATRPRSSWKREEDLPVHPHQAADHRGSLRRQTP 325 K ARP + R+ KTS A RP K +D + A + + + Sbjct: 426 KQAARPRQARQASRKTKTSKPQDQDKQAARPSCKTKL-QDQDKQSSRQASRKAKTSKTSR 484 Query: 326 TEGPGTLGVHRQTRDREIRSRREAKETGLRLKRARRKTKQQLRHKALK 469 + G +R+T+ + ++ + R KR +K KQ K K Sbjct: 485 QQNQQAPGPYRKTKTSKTSKPQDQDKQDKRDKR-EKKDKQGASRKTSK 531 >SB_33649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 723 Score = 27.9 bits (59), Expect = 5.1 Identities = 19/63 (30%), Positives = 31/63 (49%) Frame = +2 Query: 299 RGSLRRQTPTEGPGTLGVHRQTRDREIRSRREAKETGLRLKRARRKTKQQLRHKALKKGL 478 RGSL +Q + L ++ QTR + R +G R + RR + LR+ ++ L Sbjct: 646 RGSLAKQNLNDTDYALKLYNQTRPGGLSDTRLPHGSGPRSRTRRRGERTCLRNG--QRDL 703 Query: 479 DPE 487 DP+ Sbjct: 704 DPQ 706 >SB_25419| Best HMM Match : PH (HMM E-Value=2.8e-16) Length = 453 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +3 Query: 357 VKLETEKYDLEERQKRQDYDLKELEERQS 443 +KLE E +EE+Q++Q LK+ EE ++ Sbjct: 60 LKLEKEHQRMEEQQRQQQEALKQAEEERA 88 >SB_37598| Best HMM Match : TrbF (HMM E-Value=0.3) Length = 419 Score = 27.5 bits (58), Expect = 6.7 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 284 QAADH-RGSLRRQTPTEGPGTLGVHRQTRDREIRSRREAKE 403 QA H RGSL +Q T+ L ++ QTR ++ + A E Sbjct: 345 QAQSHERGSLAKQNFTDTDYALNLYNQTRPKQSLEKMRASE 385 >SB_3385| Best HMM Match : 3_5_exonuc (HMM E-Value=0.0015) Length = 437 Score = 27.5 bits (58), Expect = 6.7 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 2/84 (2%) Frame = +2 Query: 224 SATRPRSSWKREEDLPVH-PHQAADHRGSLRRQTPTEGPGT-LGVHRQTRDREIRSRREA 397 S +S+WK+ + P + A D SLR + G LGV R +++ Sbjct: 288 SKRHQQSNWKKSDLSPGQVAYAATDAWVSLRVYQEMKRHGERLGVDMMPPYRTLQNYTND 347 Query: 398 KETGLRLKRARRKTKQQLRHKALK 469 RLKR R K +Q+ + K +K Sbjct: 348 VRDSRRLKRLRYKRRQKEQRKIVK 371 >SB_52343| Best HMM Match : OTU (HMM E-Value=0.0036) Length = 1014 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 152 PARPDPTSPSKRRAKTSV*AMPSWSATRPRSSWKREEDLP 271 PA P SP+++R K S A+ +W + ++ K E +P Sbjct: 899 PADPSAASPARKRRKRSSFALGAWGG-KTDTALKSENSVP 937 >SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1805 Score = 27.5 bits (58), Expect = 6.7 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 258 KKISLSIRIKPLTIEGLSVDK--LRQKAQELWECIVKLETEKYDLEERQKRQDYDLKELE 431 KK+ + + T +S +K L +K EL + ++ E + L +++ +QD + +LE Sbjct: 1012 KKLEEDLSLVEDTNSKISKEKKTLEEKLNELDQALIDEEEKSKGLAKQKAKQDAMIADLE 1071 Query: 432 ER 437 ER Sbjct: 1072 ER 1073 >SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) Length = 1447 Score = 27.5 bits (58), Expect = 6.7 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 306 LSVDKLRQKAQELWECIVKLETEKYDLEERQKRQDYDLKELEERQ 440 + V RQK QE I L+ E +LE + + DLK + E++ Sbjct: 545 MEVSMTRQKLQEAEAKIRSLQEECKNLESQLNMANTDLKNIREKE 589 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +2 Query: 356 RQTRDREIRSRREAKETGLRLKRARRKTKQQLRHKALKKGLDPE 487 ++ R+RE R++ +E R+KR + + Q +H A +KG D + Sbjct: 1681 KREREREEERRKDVRE---RMKRRVEEIRAQRQHVAEQKGRDQQ 1721 >SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +1 Query: 97 RLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEE 255 R + E++RQA + ++DA + I+++ E A LER + +E+ E Sbjct: 574 RRQRTERQRQAKAREVRDAREKERQDRIRRERERIARERA-LERERERERERE 625 >SB_33387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 330 KAQELWECIVKLETEKYDLEERQKRQDYDLKELE 431 + EL +ET+ +ERQ +D +KELE Sbjct: 333 RVSELQNMFTSMETQLQKSQERQVEKDNQIKELE 366 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 27.1 bits (57), Expect = 8.9 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = +3 Query: 318 KLRQKAQELWECIVKLETEKYDLEERQKRQDYDLKELEERQSSN*GTKLSRRVSTPKRSQ 497 K+RQK QE + + E EK E ++R+ K+LEE + R+ + S+ Sbjct: 15 KMRQKRQEEDKAKKEAEMEKKRRREERQREAEAQKKLEEERRQQEEEIRRARLQQERLSR 74 Query: 498 AS 503 AS Sbjct: 75 AS 76 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +1 Query: 82 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEE 255 ++KR+R E+ K+RQ L+ K+ + I+K+ +L + KE+ +E Sbjct: 914 KDKREREEKERKRRQQQLE--KEKKEKEKKLLIEKEKREKEKQKERLREKEEKEKQKE 969 >SB_16859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 27.1 bits (57), Expect = 8.9 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +1 Query: 76 DIEEKR--QRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTK 240 D E++ +R + ++ L+A K S GP T KS N L + +R KT+ Sbjct: 9 DTSERKSFKRRHSSTTSQENNLKAFKGISHNGPTKTTSTKSNNKPLKLDKSKRGKTR 65 >SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) Length = 1281 Score = 27.1 bits (57), Expect = 8.9 Identities = 33/133 (24%), Positives = 55/133 (41%), Gaps = 14/133 (10%) Frame = +2 Query: 146 KMPARPDPTSPSKRRAKTSV*AMPSWSATRPRSSWKR------EEDLPVHPHQAADHRGS 307 K ARP S R+ KTS ATRPR + ++ ++ P QA+ + Sbjct: 539 KQAARPRQAS---RKTKTSKPQDQEKQATRPRQASRKTKTSKPQDKQAARPKQASRKTKT 595 Query: 308 LRRQTPTE----GPGTLGVHRQTRDREIRSR----REAKETGLRLKRARRKTKQQLRHKA 463 + P + P + Q +D++ SR R+ ++ R ++A RKTK + Sbjct: 596 SKTSKPQDKQDARPASRRTKPQDQDKQDASRKTKTRKPQDQAARPRQASRKTKTSKQPDQ 655 Query: 464 LKKGLDPEALTGK 502 K+ P + K Sbjct: 656 DKQDARPRQASRK 668 >SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1148 Score = 27.1 bits (57), Expect = 8.9 Identities = 23/89 (25%), Positives = 36/89 (40%) Frame = +2 Query: 182 KRRAKTSV*AMPSWSATRPRSSWKREEDLPVHPHQAADHRGSLRRQTPTEGPGTLGVHRQ 361 +RR +S PS RP + +D + R ++P G G R+ Sbjct: 113 RRRRSSSSERQPSTFFGRPLARRDNRDDRRESSLDRSSKWDRSRDRSPDRGYDDSGSGRR 172 Query: 362 TRDREIRSRREAKETGLRLKRARRKTKQQ 448 RD+ I +RR+ E G+ L + QQ Sbjct: 173 ERDKSIAARRD--EGGVNLNNWGTQNVQQ 199 >SB_540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 27.1 bits (57), Expect = 8.9 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 356 RQTRDR-EIRSRREAKETGLRLKRARRKTKQQLRHKALKKGLDPE 487 R +DR E R RR + + K RR++K++ KKG D E Sbjct: 107 RDKKDRKEKRDRRSKERSKDESKEERRRSKERENSPDAKKGKDKE 151 >SB_53672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 166 PNFTIQKKSENFGLSNAQLERNKTKEQLEE 255 P T + EN GLSN L ++KTK E Sbjct: 498 PTPTSSQTQENIGLSNGTLTQDKTKPGCSE 527 >SB_39563| Best HMM Match : Ctr (HMM E-Value=0.39) Length = 258 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +2 Query: 146 KMPARPDPTSPSKRRAKTSV*AMPSWSATRPRSS 247 ++ A PT P+ R+A+ S+ PS+S +R +++ Sbjct: 194 QLSAEASPTQPTVRKAEHSIEPNPSYSKSRGKTA 227 >SB_32735| Best HMM Match : DUF465 (HMM E-Value=1.7) Length = 87 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 318 KLRQKAQELWECIVKLETEKYDLEERQKRQDYDLKELE 431 +L ++ ++L E KLE +K DLE R + DLK+L+ Sbjct: 50 ELNERIEKLEEKNDKLELDKEDLEIRLEFSRNDLKKLQ 87 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 315 DKLRQKAQELWECIVKLETEKYDLEERQKRQDYDLKELEERQSS 446 DKLRQ+ L + +L+ +K DLE + R L EL +++ Sbjct: 2493 DKLRQEVSVLKQNFGQLQNDKEDLEIERDRVKRHLAELTAEKNT 2536 >SB_19503| Best HMM Match : Kinesin (HMM E-Value=9.5e-14) Length = 869 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +2 Query: 272 VHPHQAADHRGSLRRQTPTEGPGTLGVHRQTRDREIRSRREAKET 406 +HP+ +D RG RR + G HR+ + + R A +T Sbjct: 692 IHPYNRSDERGGRRRAYGSRGGEAKAGHRRRKGQPPNDVRAAWKT 736 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.300 0.115 0.292 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,079,918 Number of Sequences: 59808 Number of extensions: 203359 Number of successful extensions: 813 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 17 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.7 bits)
- SilkBase 1999-2023 -