BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30560X (438 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B3.05 |||CCR4-Not complex subunit Not3/5 |Schizosaccharomyc... 27 0.96 SPBC839.06 |cta3||P-type ATPase, calcium transporting Cta3|Schiz... 27 0.96 SPACUNK4.17 |||NAD binding dehydrogenase family protein|Schizosa... 27 1.3 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 25 6.7 SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyce... 24 8.9 SPBC1289.16c ||SPBC8E4.06|copper amine oxidase |Schizosaccharomy... 24 8.9 SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosacch... 24 8.9 >SPAC1B3.05 |||CCR4-Not complex subunit Not3/5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 27.5 bits (58), Expect = 0.96 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +2 Query: 95 TDSKSENTKKSEQQATEKVKIDIKLLDLYENSEPDVYVRTSTEEE 229 + S SEN + + +A EKV D + D+ E D +T ++ Sbjct: 248 SSSSSENLLQDKAEAEEKVSADASVQDIAEKESLDADKELATNDQ 292 >SPBC839.06 |cta3||P-type ATPase, calcium transporting Cta3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1037 Score = 27.5 bits (58), Expect = 0.96 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 271 GWQWILPQVAVMAVFFLGRCSYIDVWLRI 185 GW+W + VAVM FF Y+++W I Sbjct: 971 GWEWGVVAVAVMFYFF-----YVEIWKSI 994 >SPACUNK4.17 |||NAD binding dehydrogenase family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 405 Score = 27.1 bits (57), Expect = 1.3 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 161 IKLLDLYENSEPDVYVRTSTEEEHGHYSY 247 ++++DLYE EP +YVR+ +E Y Y Sbjct: 332 LRIVDLYE--EPVLYVRSPDSDEEKVYKY 358 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 24.6 bits (51), Expect = 6.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 179 YENSEPDVYVRTSTEEEHGHYSYLWQY 259 YEN DV+ R S + +G Y + Y Sbjct: 1274 YENGTEDVFARNSEQVYNGPYDKIRDY 1300 >SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 983 Score = 24.2 bits (50), Expect = 8.9 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 350 YLSCLVLDLHVIMTTLAITISNKSAPRMAMDIATSS 243 Y+ CL+ DL + + + I +S+ A + TSS Sbjct: 649 YMDCLLYDLRTLYSEIEIRVSDPVARFCETAVDTSS 684 >SPBC1289.16c ||SPBC8E4.06|copper amine oxidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 794 Score = 24.2 bits (50), Expect = 8.9 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +1 Query: 373 MSQPGRTKKDC-GFVYQQLFRRP 438 +SQPG T DC GF ++ P Sbjct: 531 LSQPGTTNSDCSGFAENNIYVTP 553 >SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1362 Score = 24.2 bits (50), Expect = 8.9 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = +2 Query: 95 TDSKSENTKKSEQQATEKVKIDIKLLDLYENSEPD 199 ++ K+ +T+KSE +A+E +D+ + D +E P+ Sbjct: 28 SNEKNFSTEKSENEASESHVVDV-VKDPFEQYTPE 61 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,309,173 Number of Sequences: 5004 Number of extensions: 21576 Number of successful extensions: 69 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 158122380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -