BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30558X (287 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 27 1.6 At1g48650.1 68414.m05445 helicase domain-containing protein cont... 27 1.6 At4g31390.1 68417.m04452 ABC1 family protein contains Pfam domai... 27 2.1 At3g52120.1 68416.m05721 SWAP (Suppressor-of-White-APricot)/surp... 25 6.4 At2g39180.1 68415.m04812 protein kinase family protein contains ... 25 6.4 At3g18480.1 68416.m02348 CCAAT displacement protein-related / CD... 25 8.4 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 27.5 bits (58), Expect = 1.6 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 70 PRDRGHLHRRR*SYAA*APQDPHHDY*TSNVGAARPRG 183 P H H RR + AA A Q PHH T+ G G Sbjct: 107 PSPDNHRHHRRTTTAAVAGQPPHHRRTTAAAGTTTIAG 144 >At1g48650.1 68414.m05445 helicase domain-containing protein contains similarity to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain, PF00035: Double-stranded RNA binding motif Length = 1197 Score = 27.5 bits (58), Expect = 1.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 87 MTAITRANARRPFILPFDDAFLCEAGGSR 1 MT + + R PF++PFD L E S+ Sbjct: 810 MTVVAGLSVRDPFLMPFDKKDLAETARSK 838 >At4g31390.1 68417.m04452 ABC1 family protein contains Pfam domain, PF03109: ABC1 family Length = 682 Score = 27.1 bits (57), Expect = 2.1 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = -2 Query: 223 LRHSVLDVFS--LRDVPAAELLRRWTFSSRGADPAVPTPHTTSVGGANDRD 77 + H+VL+ LR + A EL R TFS+ T T VGG N D Sbjct: 23 INHAVLNRRDALLRSLNAVELRRSRTFSAVRTSNFSVTAAATDVGGRNSTD 73 >At3g52120.1 68416.m05721 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein contains Pfam profiles PF01585: G-patch domain, PF01805: Surp module Length = 443 Score = 25.4 bits (53), Expect = 6.4 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -1 Query: 71 GPTQEDPSSCLSMMRFYVKQAA 6 GP DP LSMM FY+K+AA Sbjct: 267 GPRGADP---LSMMEFYMKKAA 285 >At2g39180.1 68415.m04812 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 776 Score = 25.4 bits (53), Expect = 6.4 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -3 Query: 276 RSLTLAILPTWYRFSSKLSDI--PCSMCSASEMSPRPSCSD 160 R L L +L W S +D P +CS SPR +C D Sbjct: 305 RELDL-VLDCWRVHDSSKADYSPPLELCSPGMCSPRGNCGD 344 >At3g18480.1 68416.m02348 CCAAT displacement protein-related / CDP-related similar to CCAAT displacement protein (CDP) (Cut-like 1) (Swiss-Prot:P39880) [Homo sapiens]; contains Pfam:PF00904 Involucrin repeat Length = 689 Score = 25.0 bits (52), Expect = 8.4 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 185 ISEAEHIEHGMSESL-DEKRYHVGKIARVNDLLNE 286 ISE H + +L +E+ HV +I ++N LLN+ Sbjct: 318 ISELNMEIHNVETALANERESHVAEIKKLNSLLNK 352 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,802,439 Number of Sequences: 28952 Number of extensions: 90636 Number of successful extensions: 296 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 296 length of database: 12,070,560 effective HSP length: 69 effective length of database: 10,072,872 effective search space used: 261894672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -