BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30556 (554 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP23A10.10 |ppk32||serine/threonine protein kinase Ppk32 |Schi... 26 3.2 SPAC9G1.09 |sid1||PAK-related kinase Sid1|Schizosaccharomyces po... 25 7.5 >SPBP23A10.10 |ppk32||serine/threonine protein kinase Ppk32 |Schizosaccharomyces pombe|chr 2|||Manual Length = 749 Score = 26.2 bits (55), Expect = 3.2 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 188 CLYNEDPQGSLLSNVLPY-NNCFADGSTINVR 280 CL ++ P G LS ++P+ CF + S++NV+ Sbjct: 427 CLKSKLPSGEFLSKIVPFIYGCF-ENSSLNVQ 457 >SPAC9G1.09 |sid1||PAK-related kinase Sid1|Schizosaccharomyces pombe|chr 1|||Manual Length = 471 Score = 25.0 bits (52), Expect = 7.5 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 224 SNVLPYNNCFADGSTI 271 SNV+ Y CF DG T+ Sbjct: 65 SNVIQYYGCFVDGYTL 80 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,756,685 Number of Sequences: 5004 Number of extensions: 31164 Number of successful extensions: 57 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 231978230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -