BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30556 (554 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 8.9 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 23 8.9 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 23 8.9 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 22.6 bits (46), Expect = 8.9 Identities = 11/31 (35%), Positives = 21/31 (67%), Gaps = 3/31 (9%) Frame = +3 Query: 81 KNLHYS*IIKMICKL---LSNYKGALINSLT 164 + +HY+ ++KM+C L L+ GA++ S+T Sbjct: 547 EEVHYAELVKMVCILSIILTAPLGAILISVT 577 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 22.6 bits (46), Expect = 8.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 111 MICKLLSNYKGALINSLTKRYLNNNIACITKIHREV 218 ++C L+ K +L KR LNN +A + R V Sbjct: 7 VLCLLVIYIKDSLQGPHEKRLLNNLLATYNTLERPV 42 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 22.6 bits (46), Expect = 8.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 111 MICKLLSNYKGALINSLTKRYLNNNIACITKIHREV 218 ++C L+ K +L KR LNN +A + R V Sbjct: 7 VLCLLVIYIKDSLQGPHEKRLLNNLLATYNTLERPV 42 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 428,771 Number of Sequences: 2352 Number of extensions: 6834 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -