BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30556 (554 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC025723-3|AAK29935.1| 254|Caenorhabditis elegans Hypothetical ... 28 3.9 U42437-3|AAA83495.1| 297|Caenorhabditis elegans Hypothetical pr... 27 6.9 U34596-1|AAA97605.1| 570|Caenorhabditis elegans SMA-4 protein. 27 9.1 U00066-5|AAA50739.2| 565|Caenorhabditis elegans Small protein 4... 27 9.1 >AC025723-3|AAK29935.1| 254|Caenorhabditis elegans Hypothetical protein Y54F10AM.6 protein. Length = 254 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 237 GSTFESKLPCGSSLYKQCC 181 GS +SK PCG YKQ C Sbjct: 83 GSVLKSKKPCGLCSYKQSC 101 >U42437-3|AAA83495.1| 297|Caenorhabditis elegans Hypothetical protein F30B5.6 protein. Length = 297 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 20 FCANFIFYNNITFMITVFYLKKLTLFVNYKNDLQII 127 F I Y N+ + T+FYLKK+ +K DL ++ Sbjct: 14 FLCETICYLNLRLLFTIFYLKKIA----FKPDLTLV 45 >U34596-1|AAA97605.1| 570|Caenorhabditis elegans SMA-4 protein. Length = 570 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 129 SNYKGALINSLTKRYLNNNIACI 197 S++ G LI S Y NNNI+C+ Sbjct: 85 SSFNGFLIPSQPSSYNNNNISCV 107 >U00066-5|AAA50739.2| 565|Caenorhabditis elegans Small protein 4, isoform a protein. Length = 565 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 129 SNYKGALINSLTKRYLNNNIACI 197 S++ G LI S Y NNNI+C+ Sbjct: 80 SSFNGFLIPSQPSSYNNNNISCV 102 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,458,417 Number of Sequences: 27780 Number of extensions: 167369 Number of successful extensions: 364 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 364 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1134321766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -