BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30554 (678 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0180 - 16031366-16031445,16031950-16032022,16032148-160321... 28 6.0 07_03_0375 + 17408815-17409035,17422820-17423477,17423780-174241... 28 7.9 01_06_1317 - 36251231-36251341,36252514-36252609,36252879-362529... 28 7.9 >02_03_0180 - 16031366-16031445,16031950-16032022,16032148-16032186, 16032434-16032715,16032790-16032948,16033034-16033390, 16033482-16033622,16033919-16034045,16034121-16034263, 16034740-16034917,16035019-16035552,16035628-16035812, 16036551-16036637,16036710-16036850,16036896-16037175, 16037944-16038020,16038326-16039138,16039292-16039801, 16039926-16040056,16040192-16040246,16040364-16040564, 16040640-16040909,16041103-16041184,16041271-16041434, 16041532-16041690,16041762-16042083,16042158-16042544, 16042811-16042999,16043233-16043317,16043458-16043753, 16043862-16043965,16044484-16044513,16044602-16044817, 16044923-16045540,16045718-16045993,16046619-16046762, 16046854-16046962,16047291-16047475,16047557-16047670, 16048348-16048479,16048929-16049249,16049424-16049891, 16054482-16054547,16054691-16054828,16054917-16055015, 16057098-16057194,16057661-16057761,16057858-16058085, 16059175-16059381,16059451-16059571,16059921-16059988, 16060148-16060213,16060396-16060509,16060949-16061300, 16063571-16063663,16063764-16063922,16064224-16064287, 16064385-16064577,16064673-16064710,16065510-16065645, 16065726-16065914,16065994-16066095,16067660-16067777, 16067861-16067964,16070338-16070346,16071428-16071475, 16071581-16071676,16072430-16072533,16073964-16074045, 16076573-16076601,16076708-16076963 Length = 4246 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 678 LKRRTASGVKNARTA*SCLGIHNSIYIINN 589 L++RTA V+ R SC+G+ + Y+++N Sbjct: 482 LQQRTAQVVQGTRGERSCVGVEPNYYVLSN 511 >07_03_0375 + 17408815-17409035,17422820-17423477,17423780-17424161, 17424236-17424550,17424727-17425118,17432479-17432508 Length = 665 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/44 (25%), Positives = 26/44 (59%) Frame = +1 Query: 364 VILYVPCAILKFYSLKRIIIFHMVFLFKHYMF*RERFMRNLGGP 495 +++++ C ++K S+ + H +F F+ YM ++++RN P Sbjct: 585 IMMHLLCHLVKEISILGPVYLHNMFPFERYMGVLKKYVRNRARP 628 >01_06_1317 - 36251231-36251341,36252514-36252609,36252879-36252956, 36253037-36253138,36254509-36254784 Length = 220 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 72 IYTLRRGGDFCDWTHKFFGPGNFKIFHMFIGFA 170 I+ ++R C W + G N+KIF +F+ +A Sbjct: 86 IHEIKRKDHHCIWINNCVGHENYKIFLVFVLYA 118 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,825,473 Number of Sequences: 37544 Number of extensions: 246993 Number of successful extensions: 433 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -