BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30549X (313 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 25 0.50 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 1.5 DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide... 23 3.5 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 25.4 bits (53), Expect = 0.50 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +3 Query: 3 VTAWFTVAFLKETYKMAIRPVYRPTIVKKRTKRFI 107 ++ WF VAF E + + P+ R T+ R + + Sbjct: 205 LSVWFVVAFTVERFIAVLYPLKRQTMCTVRRAKIV 239 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +3 Query: 12 WFTVAFLKETYKMAIRPVYRPTIVKKRTKRFIRHQSDRYDKLKRN 146 W + AFL + A V + ++R +FI R+D++ N Sbjct: 104 WCSKAFLWAYFIYACETVIVLVVARERINKFISTSDKRFDEVIYN 148 >DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide F prepropeptide protein. Length = 234 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 190 QGSILDAQHRLRFQQDDPSYA 252 Q +I Q RLRF + DPS+A Sbjct: 153 QKTIRAPQLRLRFGRTDPSWA 173 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 307,356 Number of Sequences: 2352 Number of extensions: 5492 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 20316549 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -