BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30547 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 27 0.13 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 23 2.1 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 21 4.9 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 6.5 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 8.6 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 26.6 bits (56), Expect = 0.13 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 127 RFLKFVLQQSGLNQVQWTPVYTQHSMTTLAIR 32 R++K VL +SG++ +T T+H+ T+ A R Sbjct: 268 RWIKMVLAESGVDTSIYTAHSTRHAATSAAAR 299 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 22.6 bits (46), Expect = 2.1 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -3 Query: 214 SVNLCYMTTTLDCHSDVDHREF 149 +V +C+ + CH D+ R F Sbjct: 2 AVAICFALMCIACHPDIQERIF 23 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.4 bits (43), Expect = 4.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 387 TRNLTVKPSTKPS 425 T T KPSTKP+ Sbjct: 174 TTKFTTKPSTKPT 186 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 6.5 Identities = 5/12 (41%), Positives = 8/12 (66%) Frame = +3 Query: 72 GVHWTWLSPDCC 107 G+ W ++ DCC Sbjct: 547 GIAWLYVDNDCC 558 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +3 Query: 33 RIASVVMECCV*TGVHWT 86 R+ V M+C HWT Sbjct: 179 RLLGVAMDCLKGNAKHWT 196 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,225 Number of Sequences: 336 Number of extensions: 2319 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -