BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30547 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) 148 3e-36 SB_2591| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_50457| Best HMM Match : Amidase (HMM E-Value=2.6e-36) 37 0.009 SB_35353| Best HMM Match : Arm (HMM E-Value=6.6e-27) 29 1.7 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) 27 6.9 SB_56942| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_9053| Best HMM Match : TIG (HMM E-Value=0) 27 9.2 SB_7296| Best HMM Match : PHD (HMM E-Value=0.0013) 27 9.2 SB_10519| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 148 bits (358), Expect = 3e-36 Identities = 68/97 (70%), Positives = 84/97 (86%) Frame = +2 Query: 113 KLQEPILLLGKEKFSMVDIRVTVKGGGHVAQVYAIRQAISKALIAFYRNM*TKPQRRKSK 292 K++EPILLLGKE+F VDIRV VKGGGH +++YAIRQAISK+L+A+Y+ + +++ + Sbjct: 11 KVEEPILLLGKERFEGVDIRVRVKGGGHTSRIYAIRQAISKSLVAYYQKYVDEVSKKEIR 70 Query: 293 DILVQYDRSLLVADPRRCEPKKFGGPGARARYQKSYR 403 DILVQYDRSLLVADPRR E KKFGGPGAR+RYQKSYR Sbjct: 71 DILVQYDRSLLVADPRRTEAKKFGGPGARSRYQKSYR 107 >SB_2591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 39.5 bits (88), Expect = 0.002 Identities = 30/82 (36%), Positives = 38/82 (46%) Frame = +2 Query: 5 GRKKTATAVAYCKRGHGMLRVNGRPLDLVEPRLLQYKLQEPILLLGKEKFSMVDIRVTVK 184 G +K + A A+ +G G + VN RP RL Q K Q + D V Sbjct: 338 GYRKRSVAKAWVMKGSGKITVNDRPFVEYFSRL-QDKQQILFPFQVVDCVGQFDASCHVL 396 Query: 185 GGGHVAQVYAIRQAISKALIAF 250 GGG Q AIR AIS+AL+ F Sbjct: 397 GGGLTGQAGAIRLAISRALLNF 418 >SB_50457| Best HMM Match : Amidase (HMM E-Value=2.6e-36) Length = 391 Score = 37.1 bits (82), Expect = 0.009 Identities = 31/80 (38%), Positives = 37/80 (46%) Frame = +2 Query: 164 DIRVTVKGGGHVAQVYAIRQAISKALIAFYRNM*TKPQRRKSKDILVQYDRSLLVADPRR 343 DI+V V GGG Q AI+ I++ALI F N KP K+ + D R Sbjct: 323 DIKVNVHGGGESGQAGAIKHGITRALIDF--NADLKPTLSKA---------GFVTRDARE 371 Query: 344 CEPKKFGGPGARARYQKSYR 403 E KK G AR R Q S R Sbjct: 372 VERKKCGLRKARRRKQFSKR 391 >SB_35353| Best HMM Match : Arm (HMM E-Value=6.6e-27) Length = 513 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 190 WSCSTSLRYQTSYFE-GSDRLLPKYV 264 WSCSTS+R +TS F+ GS LL + + Sbjct: 155 WSCSTSMRNRTSIFKAGSVPLLARLI 180 >SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -3 Query: 157 REFFLAEQKDRFLKFVLQQSGLNQ--VQWTP 71 R F + KDR+LK L++ G Q QW P Sbjct: 12 RSFLFTQDKDRYLKAGLKKYGYGQWTAQWVP 42 >SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) Length = 1093 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 121 LKFVLQQSGLNQVQWTPVYT 62 LK SG+N++ W PVYT Sbjct: 198 LKIQAHTSGVNRLDWNPVYT 217 >SB_56942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 380 HGHLDHRTSWARSDAGQPPANSYRIELG 297 HG L+H + WA A Q P +I+LG Sbjct: 30 HGRLNHESVWA--SASQSPGEYIQIDLG 55 >SB_9053| Best HMM Match : TIG (HMM E-Value=0) Length = 2990 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +2 Query: 131 LLLGKEKFSMVDIRVTVKGGGHVAQVYAIRQAISKALIAF 250 L +GKEK +M GGH+ + + + Q K F Sbjct: 463 LWIGKEKNTMTPSSAPAMPGGHLVRSFKVEQVADKVFKTF 502 >SB_7296| Best HMM Match : PHD (HMM E-Value=0.0013) Length = 873 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 84 TWLSPDCCSTNFRNLSFCSARKNSLWSTS 170 TW+ P C S+NF + S ++ NS+ STS Sbjct: 716 TWICPCCGSSNFSSGSIFTSSSNSI-STS 743 >SB_10519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 873 Score = 27.1 bits (57), Expect = 9.2 Identities = 20/70 (28%), Positives = 32/70 (45%) Frame = +1 Query: 97 QTAAVQTSGTYPFARQGKILYGRHQSDSQGWWSCSTSLRYQTSYFEGSDRLLPKYVDEAS 276 Q + Q G Y +GK+L+ +D Q + C +T Y + DRL +++D Sbjct: 23 QLLSEQLKG-YDARTEGKVLF---LADLQEY--CKKMSEVETEYSKNLDRLSDRFLDRLQ 76 Query: 277 KKEIQRHPSS 306 K + QR S Sbjct: 77 KFKAQRKERS 86 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,928,010 Number of Sequences: 59808 Number of extensions: 298375 Number of successful extensions: 698 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 697 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -