BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30544 (594 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 23 2.3 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 23 2.3 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 23 2.3 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 3.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 3.9 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 22 5.2 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 6.9 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 6.9 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 23.0 bits (47), Expect = 2.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 238 WCTGLLHLSSWFNWHLGKFC*SHICCHCQDIC 143 WC G + SS N LG+F + CC D+C Sbjct: 36 WC-GHGNKSSGPN-ELGRFKHTDACCRTHDMC 65 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 23.0 bits (47), Expect = 2.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 238 WCTGLLHLSSWFNWHLGKFC*SHICCHCQDIC 143 WC G + SS N LG+F + CC D+C Sbjct: 41 WC-GHGNKSSGPN-ELGRFKHTDACCRTHDMC 70 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 23.0 bits (47), Expect = 2.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 238 WCTGLLHLSSWFNWHLGKFC*SHICCHCQDIC 143 WC G + SS N LG+F + CC D+C Sbjct: 41 WC-GHGNKSSGPN-ELGRFKHTDACCRTHDMC 70 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 477 NMTVVVANGNNALKRVRC 530 N +++AN N+ +K RC Sbjct: 396 NFRILIANVNDLIKNTRC 413 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 487 TVILVWV*SAARKSPL 440 T++LVW SAA SP+ Sbjct: 306 TILLVWAISAAIGSPI 321 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.8 bits (44), Expect = 5.2 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -2 Query: 344 CKVTGKCGSVTVRLIPAPRGT 282 C + G CG + + P+GT Sbjct: 75 CPICGACGDIAHTVKYCPKGT 95 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.4 bits (43), Expect = 6.9 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -2 Query: 266 PVPKSFFRWLVYRTATPQLVVQLAPWEILLKPHMLPLPRHMPTS 135 PV K+F ++ L VQ A I+ K + LP+ H +S Sbjct: 451 PVLKNFPTRYIHEPWNAPLNVQRAAKCIIGKDYSLPMVNHSKSS 494 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -2 Query: 158 LPRHMPTSL 132 LP+H+PTSL Sbjct: 379 LPKHLPTSL 387 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,201 Number of Sequences: 438 Number of extensions: 4014 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -