BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30543 (800 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 29 0.033 EF222299-1|ABN79659.1| 136|Tribolium castaneum ion transport pe... 23 3.7 EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport pe... 23 3.7 EF222297-1|ABN79657.1| 140|Tribolium castaneum ion transport pe... 23 3.7 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 22 5.0 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 29.5 bits (63), Expect = 0.033 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +1 Query: 610 LQDFHHSPAVLDYRAPHIAVACLTLALHVLGVSVPLASTLDDDAAW 747 LQ HHSP + P+ A A HV+G +VP D DA + Sbjct: 36 LQGLHHSPHLNHAMHPYHANHVNPTANHVMGGAVPDVGKRDKDAIY 81 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 541 SLQEWFPVAQWRSAPIARMA 600 ++ +W P +W S P AR A Sbjct: 271 AMGKWCPRREWSSPPDARAA 290 >EF222299-1|ABN79659.1| 136|Tribolium castaneum ion transport peptide isoform C protein. Length = 136 Score = 22.6 bits (46), Expect = 3.7 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -2 Query: 325 TQTSSADYVAVVIILVGLFEEFVVNMAAVAIVAGCKPSFIPHSKTK 188 +++ S V V ++L +F+E + A G P+F+PH TK Sbjct: 6 SKSISTQAVWVCMVLAVVFQEITSSPA------GRSPAFLPHHFTK 45 >EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport peptide isoform B protein. Length = 120 Score = 22.6 bits (46), Expect = 3.7 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -2 Query: 325 TQTSSADYVAVVIILVGLFEEFVVNMAAVAIVAGCKPSFIPHSKTK 188 +++ S V V ++L +F+E + A G P+F+PH TK Sbjct: 6 SKSISTQAVWVCMVLAVVFQEITSSPA------GRSPAFLPHHFTK 45 >EF222297-1|ABN79657.1| 140|Tribolium castaneum ion transport peptide isoform A protein. Length = 140 Score = 22.6 bits (46), Expect = 3.7 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -2 Query: 325 TQTSSADYVAVVIILVGLFEEFVVNMAAVAIVAGCKPSFIPHSKTK 188 +++ S V V ++L +F+E + A G P+F+PH TK Sbjct: 6 SKSISTQAVWVCMVLAVVFQEITSSPA------GRSPAFLPHHFTK 45 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 541 SLQEWFPVAQWRSAPIARMA 600 ++ +W P +W S P AR A Sbjct: 115 AMGKWCPRREWSSPPDARAA 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,224 Number of Sequences: 336 Number of extensions: 3546 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -