BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30541 (576 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schi... 29 0.37 SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|c... 29 0.64 SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|c... 26 4.5 SPCC1020.13c ||SPCC14G10.05|phospholipase |Schizosaccharomyces p... 26 4.5 SPBC1703.02 |rsc9||RSC complex subunit Rsc9|Schizosaccharomyces ... 25 7.9 >SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schizosaccharomyces pombe|chr 2|||Manual Length = 470 Score = 29.5 bits (63), Expect = 0.37 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -3 Query: 421 HNPVLRLHYLNLSREFRSLARGGGDL--RNRFTLSMVSSLVSEVRN 290 HNP L L +SRE SL D + R TL +S+LVS +N Sbjct: 255 HNPSTLLSILPISRELNSLLNRIFDRNPKTRITLPELSTLVSNCKN 300 >SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 594 Score = 28.7 bits (61), Expect = 0.64 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +3 Query: 225 PHVIVAVRGSTVTRTLTANLKPLRTSLTRLDTMLRVNLFLRSPPPRAKLLNSL 383 P I + G + TLTA+L+ T L+T L+ + PP L++S+ Sbjct: 125 PDSIEGIPGCHIIYTLTASLERATQPPTNLETALQFRVIRTIPPNSLDLMHSV 177 >SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 625 Score = 25.8 bits (54), Expect = 4.5 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 Query: 198 KEALDDDNKPHVIVAVRGSTVTRTLTANLKPLRT 299 KE D+K H++VA GS LT +K L T Sbjct: 22 KERQLTDSKYHILVAATGSVAAIKLTLIVKSLLT 55 >SPCC1020.13c ||SPCC14G10.05|phospholipase |Schizosaccharomyces pombe|chr 3|||Manual Length = 669 Score = 25.8 bits (54), Expect = 4.5 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 198 KEALDDDNKPHVIVAVRGSTVTRTLTANLKPLR-TSLTRLDTM 323 +E + N+ +VIV + G V T LKPL S ++ DT+ Sbjct: 59 EEVSQEPNQKNVIVGISGLHVVNLPTLTLKPLYWPSASKNDTL 101 >SPBC1703.02 |rsc9||RSC complex subunit Rsc9|Schizosaccharomyces pombe|chr 2|||Manual Length = 780 Score = 25.0 bits (52), Expect = 7.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 216 RRREPPSAHQFRYARCRW 163 RR+ P S + RY CRW Sbjct: 607 RRKFPTSVNGMRYQPCRW 624 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,118,047 Number of Sequences: 5004 Number of extensions: 39004 Number of successful extensions: 113 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -