BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30538 (392 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 25 0.27 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 25 0.27 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 3.3 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 3.3 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 25.0 bits (52), Expect = 0.27 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 37 QADHPRQVQQHHQVAGFQPAGRQG 108 Q HP+ Q HHQ G+QG Sbjct: 172 QEQHPQHHQPHHQQQHMMYGGQQG 195 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 25.0 bits (52), Expect = 0.27 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 37 QADHPRQVQQHHQVAGFQPAGRQG 108 Q HP+ Q HHQ G+QG Sbjct: 174 QEQHPQHHQPHHQQQHMMYGGQQG 197 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 3.3 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 188 LLRHPGTSS*LSDCKCLPILSACAHTPPCRPAGWNP 81 +L+ P T D K LP H PP P G NP Sbjct: 720 MLQSPLTPHEAFDVK-LPPPPHPHHQPPRNPVGTNP 754 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 3.3 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 188 LLRHPGTSS*LSDCKCLPILSACAHTPPCRPAGWNP 81 +L+ P T D K LP H PP P G NP Sbjct: 612 MLQSPLTPHEAFDVK-LPPPPHPHHQPPRNPVGTNP 646 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,615 Number of Sequences: 336 Number of extensions: 1713 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8330471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -