BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30536X (509 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 1.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 1.8 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 1.8 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 1.8 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 7.4 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 21 7.4 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.0 bits (47), Expect = 1.8 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -1 Query: 344 CLKTSLRLTPAKFLYMSAIFVLGCGSMT-SISTFRRCRKEVPVR 216 CLK L T + Y + +F+ G +T S TF VP R Sbjct: 289 CLKVDLIFTRDRAFYFTTVFIPGIILVTSSFITFWLEWNAVPAR 332 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.0 bits (47), Expect = 1.8 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -1 Query: 344 CLKTSLRLTPAKFLYMSAIFVLGCGSMT-SISTFRRCRKEVPVR 216 CLK L T + Y + +F+ G +T S TF VP R Sbjct: 258 CLKVDLIFTRDRAFYFTTVFIPGIILVTSSFITFWLEWNAVPAR 301 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.0 bits (47), Expect = 1.8 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -1 Query: 344 CLKTSLRLTPAKFLYMSAIFVLGCGSMT-SISTFRRCRKEVPVR 216 CLK L T + Y + +F+ G +T S TF VP R Sbjct: 309 CLKVDLIFTRDRAFYFTTVFIPGIILVTSSFITFWLEWNAVPAR 352 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.0 bits (47), Expect = 1.8 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -1 Query: 344 CLKTSLRLTPAKFLYMSAIFVLGCGSMT-SISTFRRCRKEVPVR 216 CLK L T + Y + +F+ G +T S TF VP R Sbjct: 258 CLKVDLIFTRDRAFYFTTVFIPGIILVTSSFITFWLEWNAVPAR 301 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 506 SFVTRWKLAKSGWNM 462 S VTR KL + GW++ Sbjct: 130 SLVTRQKLLELGWDV 144 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 506 SFVTRWKLAKSGWNM 462 S VTR KL + GW++ Sbjct: 252 SLVTRQKLLELGWDV 266 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,160 Number of Sequences: 438 Number of extensions: 2609 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14109465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -