BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30533 (751 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL391650-8|CAI17137.1| 134|Homo sapiens zinc finger protein 593... 60 6e-09 D45213-1|BAA20369.1| 116|Homo sapiens zinc finger protein protein. 58 3e-08 BC019267-1|AAH19267.1| 116|Homo sapiens zinc finger protein 593... 58 3e-08 BC002580-1|AAH02580.1| 116|Homo sapiens zinc finger protein 593... 58 3e-08 >AL391650-8|CAI17137.1| 134|Homo sapiens zinc finger protein 593 protein. Length = 134 Score = 60.5 bits (140), Expect = 6e-09 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 3/69 (4%) Frame = +1 Query: 55 LKKRWRVRNRKKDLDEIDQDLKEENAEKLL---NQKVDLDLPGAAQHYCLHCARYFIDEQ 225 L ++ + + R+ DLDEI ++L+ + + + N + D DLPG H CL CARYFID Sbjct: 15 LARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDST 74 Query: 226 ALNDHFKTK 252 L HF++K Sbjct: 75 NLKTHFRSK 83 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = +3 Query: 222 TSFE*SFQDKSHKRRLKALELEPYTIEESERAAGHGSF 335 T+ + F+ K HK+RLK L +EPY+ EE+ERAAG GS+ Sbjct: 74 TNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSY 111 >D45213-1|BAA20369.1| 116|Homo sapiens zinc finger protein protein. Length = 116 Score = 58.4 bits (135), Expect = 3e-08 Identities = 27/64 (42%), Positives = 39/64 (60%), Gaps = 3/64 (4%) Frame = +1 Query: 70 RVRNRKKDLDEIDQDLKEENAEKLL---NQKVDLDLPGAAQHYCLHCARYFIDEQALNDH 240 + + R+ DLDEI ++L+ + + + N + D DLPG H CL CARYFID L H Sbjct: 2 KAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTH 61 Query: 241 FKTK 252 F++K Sbjct: 62 FRSK 65 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = +3 Query: 222 TSFE*SFQDKSHKRRLKALELEPYTIEESERAAGHGSF 335 T+ + F+ K HK+RLK L +EPY+ EE+ERAAG GS+ Sbjct: 56 TNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSY 93 >BC019267-1|AAH19267.1| 116|Homo sapiens zinc finger protein 593 protein. Length = 116 Score = 58.4 bits (135), Expect = 3e-08 Identities = 27/64 (42%), Positives = 39/64 (60%), Gaps = 3/64 (4%) Frame = +1 Query: 70 RVRNRKKDLDEIDQDLKEENAEKLL---NQKVDLDLPGAAQHYCLHCARYFIDEQALNDH 240 + + R+ DLDEI ++L+ + + + N + D DLPG H CL CARYFID L H Sbjct: 2 KAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTH 61 Query: 241 FKTK 252 F++K Sbjct: 62 FRSK 65 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = +3 Query: 222 TSFE*SFQDKSHKRRLKALELEPYTIEESERAAGHGSF 335 T+ + F+ K HK+RLK L +EPY+ EE+ERAAG GS+ Sbjct: 56 TNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSY 93 >BC002580-1|AAH02580.1| 116|Homo sapiens zinc finger protein 593 protein. Length = 116 Score = 58.4 bits (135), Expect = 3e-08 Identities = 27/64 (42%), Positives = 39/64 (60%), Gaps = 3/64 (4%) Frame = +1 Query: 70 RVRNRKKDLDEIDQDLKEENAEKLL---NQKVDLDLPGAAQHYCLHCARYFIDEQALNDH 240 + + R+ DLDEI ++L+ + + + N + D DLPG H CL CARYFID L H Sbjct: 2 KAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTH 61 Query: 241 FKTK 252 F++K Sbjct: 62 FRSK 65 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = +3 Query: 222 TSFE*SFQDKSHKRRLKALELEPYTIEESERAAGHGSF 335 T+ + F+ K HK+RLK L +EPY+ EE+ERAAG GS+ Sbjct: 56 TNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSY 93 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,881,001 Number of Sequences: 237096 Number of extensions: 1643049 Number of successful extensions: 4818 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4814 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9015132854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -