BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30533 (751 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36930.1 68415.m04529 zinc finger (C2H2 type) family protein ... 50 1e-06 At5g54460.1 68418.m06782 wound-responsive protein-related contai... 29 2.5 At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nic... 29 2.5 At3g25130.1 68416.m03138 expressed protein 29 2.5 At5g37160.1 68418.m04461 tRNA-splicing endonuclease positive eff... 29 3.3 At1g54920.2 68414.m06269 expressed protein 29 3.3 At1g54920.1 68414.m06270 expressed protein 29 3.3 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 28 5.8 At2g01950.1 68415.m00130 leucine-rich repeat transmembrane prote... 28 5.8 At3g05670.1 68416.m00631 PHD finger family protein contains Pfam... 28 7.6 At3g02560.2 68416.m00247 40S ribosomal protein S7 (RPS7B) simila... 28 7.6 At3g02560.1 68416.m00246 40S ribosomal protein S7 (RPS7B) simila... 28 7.6 At1g61770.1 68414.m06966 DNAJ heat shock N-terminal domain-conta... 28 7.6 At1g28430.1 68414.m03495 cytochrome P450, putative similar to cy... 28 7.6 >At2g36930.1 68415.m04529 zinc finger (C2H2 type) family protein contains Prosite PS00028: Zinc finger, C2H2 type, domain; weak similarity to Zinc finger protein T86 (Swiss-Prot:O00488) [Homo sapiens] Length = 198 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/34 (58%), Positives = 24/34 (70%) Frame = +1 Query: 151 KVDLDLPGAAQHYCLHCARYFIDEQALNDHFKTK 252 ++D DLPG Q YCLHC RYF + +DHFKTK Sbjct: 47 QLDEDLPGMGQFYCLHCDRYFSNVSVRDDHFKTK 80 Score = 35.1 bits (77), Expect = 0.050 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +1 Query: 163 DLPGAAQHYCLHCARYFIDEQALNDHFKTK 252 DLPG Q CL C R F + ++ HFKTK Sbjct: 131 DLPGMGQFNCLLCHRNFSNASVMDYHFKTK 160 >At5g54460.1 68418.m06782 wound-responsive protein-related contains weak similarity to KED [Nicotiana tabacum] gi|8096269|dbj|BAA95789 Length = 141 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +1 Query: 4 QTDMTYKRKKYHCGDTHLKKRWRVRNRKKDLDEIDQDLKEENAEKLLNQK 153 + D+ R+KY G T LKK + RK ++ +KEE AE + +K Sbjct: 73 ELDLQKGREKYK-GATRLKKEKKKWERKNKRNQSKSPVKEEGAEPVKEEK 121 >At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 1008 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = +3 Query: 243 QDKSHKRRLKALELEPYTIEESERAAGHGSFKKATKRKIVSQNIEKSQTDE 395 +DK K + KA E+E EE+E HG KK KRK E + +E Sbjct: 699 KDKKGKAKQKAEEIEVTGKEENETDK-HGKMKKERKRKKSESKKEGGEGEE 748 >At3g25130.1 68416.m03138 expressed protein Length = 406 Score = 29.5 bits (63), Expect = 2.5 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 662 LEDLWHVYEELRQKRNQYEQQKDRLAKE 745 ++ LW YE +K+ Q E++K +L K+ Sbjct: 305 MDQLWETYETQTEKKQQTEEEKKKLKKK 332 >At5g37160.1 68418.m04461 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 871 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = +1 Query: 58 KKRWRVRNRKKDLDEIDQ-DLKEENAEKLLNQKVDLDLPGAAQHYCLHCARYFIDEQALN 234 KK+ V R + E+D DL + ++ K +L A Q LH RYF+ E + Sbjct: 433 KKKEEVEERT--MQEVDMADLSTHLPKSFISSKDVKNLIAACQ--ALHRVRYFLQENSSR 488 Query: 235 DHFK 246 D FK Sbjct: 489 DDFK 492 >At1g54920.2 68414.m06269 expressed protein Length = 890 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 22 KRKKYHCGDTHLKKRWRVRNRKKDLDEIDQ-DLKEENAEKLLNQKV 156 K + YH HL+K R++ D DE+ + D + E+ + LLN V Sbjct: 582 KIELYHIALYHLEKLKEARDKAADSDEVQKCDSEIEDLQNLLNNDV 627 >At1g54920.1 68414.m06270 expressed protein Length = 430 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 22 KRKKYHCGDTHLKKRWRVRNRKKDLDEIDQ-DLKEENAEKLLNQKV 156 K + YH HL+K R++ D DE+ + D + E+ + LLN V Sbjct: 246 KIELYHIALYHLEKLKEARDKAADSDEVQKCDSEIEDLQNLLNNDV 291 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 28.3 bits (60), Expect = 5.8 Identities = 21/106 (19%), Positives = 53/106 (50%), Gaps = 1/106 (0%) Frame = +1 Query: 235 DHFKTKVINGD*KHSSLNLI-L*KSQRELLATGVSKKQQNEKLFHKILRNLKQMKMVMLF 411 DHF + K LI + ++ R+ + + + E + ++ + K+++ +++ Sbjct: 218 DHFSNSSGDHQVKEDLEALIKMREALRDEVMVMEERLEVKEVVCSELQKKSKRLEDLLIN 277 Query: 412 *RKVQTKRRKLMTMIYKTYFYTLFKTRNLLVTQKDIQLFSSMVPRQ 549 +K+ ++RRK + ++K+Y T NL ++++QL + R+ Sbjct: 278 EKKLVSQRRKELAKLHKSYSRVRECTDNLKDCEQELQLLVNSAARE 323 >At2g01950.1 68415.m00130 leucine-rich repeat transmembrane protein kinase, putative similar to brassinosteroid insensitive protein Length = 1143 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +1 Query: 31 KYHCGDTHLKKRWRVRNRK-KDLDEIDQDLKEENAEKLLNQK 153 K GDT+L +++ R+ K ++ ID+DL +E + + LN+K Sbjct: 1045 KEEFGDTNLVGWSKMKAREGKHMEVIDEDLLKEGSSESLNEK 1086 >At3g05670.1 68416.m00631 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 883 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 22 KRKKYHCGDTHLKK--RWRVRNRKKDLDEIDQDLKEE 126 +RKK T L + + RVRN KK +DE D D ++ Sbjct: 275 RRKKCSVAKTRLTRGRKRRVRNTKKGVDEDDDDFVDD 311 >At3g02560.2 68416.m00247 40S ribosomal protein S7 (RPS7B) similar to ribosomal protein S7 GB:AAD26256 from [Secale cereale] Length = 191 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 91 DLDEIDQDLKEENAEKLLNQKVDLDLPG 174 DL+ +Q+LK E + +NQ V +D+ G Sbjct: 29 DLENTNQELKSELKDLYINQAVQMDISG 56 >At3g02560.1 68416.m00246 40S ribosomal protein S7 (RPS7B) similar to ribosomal protein S7 GB:AAD26256 from [Secale cereale] Length = 191 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 91 DLDEIDQDLKEENAEKLLNQKVDLDLPG 174 DL+ +Q+LK E + +NQ V +D+ G Sbjct: 29 DLENTNQELKSELKDLYINQAVQMDISG 56 >At1g61770.1 68414.m06966 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9UBS4 DnaJ homolog subfamily B member 11 precursor Homo sapiens; contains Pfam profile PF00226 DnaJ domain Length = 300 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +1 Query: 55 LKKRWRVRNRKKDLDEIDQDLKEENAEKLLNQKVDLDLPGA 177 L++ V N+KK +IDQ L+EE L+ ++DL + GA Sbjct: 167 LERTGGVSNKKKGSKQIDQKLQEE-----LSNELDLQIKGA 202 >At1g28430.1 68414.m03495 cytochrome P450, putative similar to cytochrome P450 (CYP93A1) GI:1435059 from [Glycine max] Length = 521 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/54 (27%), Positives = 32/54 (59%) Frame = -1 Query: 181 VLLLADLNQLFGSVIFQHFLPLNLGLFHPNLSFCYALSTAFLNVCRHNDISCAY 20 +LL A +++ F + ++ L+L +FH + + STA+ ++ + NDI+ +Y Sbjct: 55 LLLFASIHKCFQKISSKYGPFLHLRIFHVPIVLVSSASTAY-DIFKTNDINVSY 107 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,770,817 Number of Sequences: 28952 Number of extensions: 261177 Number of successful extensions: 927 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 925 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -