BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30527X (378 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 3.6 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 3.6 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 3.6 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 3.6 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 3.6 Identities = 9/37 (24%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 116 IWVKLRGHFVDYLVQLYTIITLNPN-G*VWIPQVYRL 9 +W K + Y+ LYT + P+ + +P +Y + Sbjct: 129 LWAKNNINEAQYIYSLYTAVITRPDTKFIQLPPLYEM 165 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 3.6 Identities = 9/37 (24%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 116 IWVKLRGHFVDYLVQLYTIITLNPN-G*VWIPQVYRL 9 +W K + Y+ LYT + P+ + +P +Y + Sbjct: 129 LWAKNNINEAQYIYSLYTAVITRPDTKFIQLPPLYEM 165 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.4 bits (43), Expect = 3.6 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -2 Query: 35 VWIPQVYRL 9 +W+PQ YRL Sbjct: 131 IWVPQKYRL 139 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 3.6 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -2 Query: 35 VWIPQVYRL 9 +W+PQ YRL Sbjct: 131 IWVPQKYRL 139 Score = 20.2 bits (40), Expect = 8.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 99 PKFDPNEIKIVNLRCVGGEVGATSSLA 179 P PN K++ GE G +SLA Sbjct: 588 PDPXPNTCKVIASSVSAGEEGLGNSLA 614 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,790 Number of Sequences: 438 Number of extensions: 2046 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9176370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -