BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30525 (544 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|S... 61 9e-11 SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Sc... 61 9e-11 SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|... 57 2e-09 SPCC18.14c |rpp0||60S acidic ribosomal protein Rpp0 |Schizosacch... 27 1.8 SPBP8B7.06 |rpp201|rpp2, rpp2-1|60S acidic ribosomal protein P2A... 27 1.8 SPBC23G7.15c |rpp202|rpp2-2|60S acidic ribosomal protein P2B sub... 27 1.8 SPAC1071.08 |rpp203|rpp2-3, rla6|60S acidic ribosomal protein P2... 27 1.8 SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces ... 25 9.5 >SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 61.3 bits (142), Expect = 9e-11 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +1 Query: 103 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALE 255 +S +ELA YSALIL D+ + +T +K+ ++ KAA VDVEP W +FAKALE Sbjct: 1 MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALE 51 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 402 SDDDMGFGLFD 434 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Schizosaccharomyces pombe|chr 1|||Manual Length = 109 Score = 61.3 bits (142), Expect = 9e-11 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +1 Query: 103 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALE 255 +S +ELA YSALIL D+ + +T +K+ ++ KAA VDVEP W +FAKALE Sbjct: 1 MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALE 51 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 402 SDDDMGFGLFD 434 SD+DMGFGLFD Sbjct: 99 SDEDMGFGLFD 109 >SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|Schizosaccharomyces pombe|chr 3|||Manual Length = 109 Score = 56.8 bits (131), Expect = 2e-09 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = +1 Query: 103 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALE 255 +S +ELA Y+ALIL D+ + +T +K+ ++ KA V+VEP W +FAKALE Sbjct: 1 MSASELATSYAALILADEGIEITSDKLLSLTKAGNVEVEPIWATIFAKALE 51 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 402 SDDDMGFGLFD 434 SD+DMGFGLFD Sbjct: 99 SDEDMGFGLFD 109 >SPCC18.14c |rpp0||60S acidic ribosomal protein Rpp0 |Schizosaccharomyces pombe|chr 3|||Manual Length = 312 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 402 SDDDMGFGLFD 434 SD+DMGFGLFD Sbjct: 302 SDEDMGFGLFD 312 >SPBP8B7.06 |rpp201|rpp2, rpp2-1|60S acidic ribosomal protein P2A subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 402 SDDDMGFGLFD 434 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPBC23G7.15c |rpp202|rpp2-2|60S acidic ribosomal protein P2B subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 402 SDDDMGFGLFD 434 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPAC1071.08 |rpp203|rpp2-3, rla6|60S acidic ribosomal protein P2C subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 110 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 402 SDDDMGFGLFD 434 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 315 Score = 24.6 bits (51), Expect = 9.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 67 GLRQLARSKLKMVSKAELACVYSAL 141 G+ QL + ++SKA+L C Y L Sbjct: 159 GMLQLDMPHVNILSKADLLCTYGTL 183 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,658,656 Number of Sequences: 5004 Number of extensions: 27640 Number of successful extensions: 74 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 223909422 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -