BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30525 (544 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0113 + 897970-898038,898148-898271,898811-898896,898996-89... 69 2e-12 02_02_0220 - 7992124-7992351,7992458-7992562,7993499-7993711,799... 29 1.8 01_01_0256 - 2083973-2084816,2084922-2086093 29 2.4 12_02_0735 - 22636835-22639502,22639755-22640734 27 9.7 09_04_0115 - 14789499-14790288,14792055-14792441,14792820-14793193 27 9.7 05_03_0235 - 10747649-10748118,10748226-10748314,10748477-107485... 27 9.7 >08_01_0113 + 897970-898038,898148-898271,898811-898896,898996-899049 Length = 110 Score = 68.9 bits (161), Expect = 2e-12 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = +1 Query: 103 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALE 255 +S +E+AC +ALIL DD + +T EKI+T++KAA + VE YWPGLFAK LE Sbjct: 1 MSSSEVACTLAALILHDDGIPITSEKIATLVKAANIKVEAYWPGLFAKLLE 51 >02_02_0220 - 7992124-7992351,7992458-7992562,7993499-7993711, 7993937-7994196,7994425-7994701,7995226-7995371, 7995519-7995903,7996680-7996964 Length = 632 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/41 (34%), Positives = 26/41 (63%) Frame = +1 Query: 67 GLRQLARSKLKMVSKAELACVYSALILVDDDVAVTGEKIST 189 G+R+LA+ V+K + S +L+ +DVA+TG+ ++T Sbjct: 249 GIRKLAQIFQSSVAKKKAVGKKSKALLLGEDVAITGDCVTT 289 >01_01_0256 - 2083973-2084816,2084922-2086093 Length = 671 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -1 Query: 295 PEPMLVIRSRTLMPPRLWRTDLANMALHLQ-PPLSRWWKFSHQLRQHHHP 149 P P + ++ L P L+RT A + P + H ++ HHHP Sbjct: 564 PIPQMAVKQPELQQPGLYRTTAAPTPVPASNAPAYAGMGYHHVIQTHHHP 613 >12_02_0735 - 22636835-22639502,22639755-22640734 Length = 1215 Score = 27.1 bits (57), Expect = 9.7 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Frame = -3 Query: 287 DVGDQVTDIDASKALANRP--GQYGSTSTAAAFKMVEIFSPVTATSSSTRMRAE*THANS 114 D D VTD D +A+++ Q TS A F +V A ++ AE HA Sbjct: 209 DESDSVTDDDDDEAVSSSEERDQLPLTSMARKFSVVHSMKVPGAAANGNGKPAEFDHARW 268 Query: 113 AFDT 102 F+T Sbjct: 269 LFET 272 >09_04_0115 - 14789499-14790288,14792055-14792441,14792820-14793193 Length = 516 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -3 Query: 287 DVGDQVTDIDASKALANRPGQYGSTSTAAAFKMVEIFSPVTATSSST 147 DVG + DAS +R G S AAA + SP +A +++T Sbjct: 4 DVGAEDAAADASTGGGSRRGSVPGGSAAAASRAAPPASPTSAAAATT 50 >05_03_0235 - 10747649-10748118,10748226-10748314,10748477-10748574, 10748934-10749046,10749107-10749200,10749557-10749589, 10749734-10749851,10750110-10750210,10751036-10751233, 10751337-10751471,10751752-10751830,10753650-10753738, 10753835-10753987,10754100-10754285 Length = 651 Score = 27.1 bits (57), Expect = 9.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 175 HQLRQHHHPPG*EQSKH 125 HQ R+HHHPP + H Sbjct: 562 HQRRRHHHPPAWDVEGH 578 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,285,393 Number of Sequences: 37544 Number of extensions: 213033 Number of successful extensions: 547 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1210221432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -