BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30521 (865 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB17E12.07c |sen2||tRNA-splicing endonuclease subunit Sen2|Sc... 30 0.37 SPAC2C4.06c |||rRNA methyltransferase |Schizosaccharomyces pombe... 28 2.0 >SPAPB17E12.07c |sen2||tRNA-splicing endonuclease subunit Sen2|Schizosaccharomyces pombe|chr 1|||Manual Length = 380 Score = 30.3 bits (65), Expect = 0.37 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = -1 Query: 277 ILELFAGLNFISVVLKVE-EVTKLYSSPSLRSSTVGVTVLAALRVIRPTPMVFMNSSKFS 101 IL+LFA + SV L + + + + P + +T LAA R V N +KFS Sbjct: 216 ILKLFANIVANSVALTHDYSLQQSHEDPIIEPDNKFLTELAAYFYFRQQGWVVKNGTKFS 275 Query: 100 EEVILY 83 + +LY Sbjct: 276 VDFLLY 281 >SPAC2C4.06c |||rRNA methyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 455 Score = 27.9 bits (59), Expect = 2.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 275 DVRSDGAKVKSVCTFEGNTLKQVQMAPDGLEVTY 376 DV D +++++C+F+ LK P+ VTY Sbjct: 309 DVTEDTERLENLCSFQSTILKHALQFPNCRHVTY 342 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,156,774 Number of Sequences: 5004 Number of extensions: 36822 Number of successful extensions: 83 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 430470850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -