BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30521 (865 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles ... 70 1e-13 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 9.1 >U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles gambiae putativefatty acid binding protein mRNA, partial cds. ). Length = 141 Score = 69.7 bits (163), Expect = 1e-13 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = +3 Query: 75 GKKYKMTSSENFDEFMKTIGVGLITRKAANTVTPTVELRKDGDEYNLVTSSTFKT 239 GKKYKM SE FD++M +GVG++ RK N+++PTVEL K+GDEY T S +T Sbjct: 35 GKKYKMEKSEGFDDYMLALGVGMVLRKLGNSISPTVELVKNGDEYTFNTLSPSRT 89 Score = 31.5 bits (68), Expect = 0.034 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 Query: 266 EF*DVRSDGAKVKSVCTFEGNTL 334 EF + DG VKSVCTF+GN L Sbjct: 99 EFDEETVDGRMVKSVCTFDGNKL 121 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.4 bits (48), Expect = 9.1 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -1 Query: 358 VGGHLNLLECIAFECAYGFHLSTVRADILELFAGL 254 V G + C CAYG H S +++ +F L Sbjct: 466 VNGTWDFSACEETSCAYGLHNSFQVMELVSVFGPL 500 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 556,038 Number of Sequences: 2352 Number of extensions: 9928 Number of successful extensions: 59 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 92199573 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -