BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30521 (865 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24740.1 68418.m02920 expressed protein 28 7.0 At5g24880.1 68418.m02946 expressed protein ; expression supporte... 28 9.2 >At5g24740.1 68418.m02920 expressed protein Length = 3306 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/62 (24%), Positives = 31/62 (50%) Frame = -1 Query: 343 NLLECIAFECAYGFHLSTVRADILELFAGLNFISVVLKVEEVTKLYSSPSLRSSTVGVTV 164 N+++ I EC + RAD L +F +S++L +++ + RS T+ ++ Sbjct: 1118 NVVQHIPQECVIPLNQVLGRADCLNIFGRDLSVSLLLSESDISTFKKNAVCRSITLAASI 1177 Query: 163 LA 158 +A Sbjct: 1178 IA 1179 >At5g24880.1 68418.m02946 expressed protein ; expression supported by MPSS Length = 443 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +2 Query: 2 GAKNRRIKNLSLKSIKLIYKNGIRRQEIQDDFLREL**VHEDHRRGSDH 148 G++N RIK S K I L + Q+D E+ V DH + SDH Sbjct: 173 GSENVRIKKASDKEIAL---DSASMSSAQEDHQEEILKVESDHLQVSDH 218 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,398,873 Number of Sequences: 28952 Number of extensions: 198964 Number of successful extensions: 414 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2019160800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -