BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30516 (533 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 27 0.16 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 25 0.64 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 25 0.64 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.1 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 23 2.6 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 4.5 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 6.0 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 7.9 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 7.9 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 21 7.9 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 26.6 bits (56), Expect = 0.16 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +2 Query: 263 KIPDWFLNRQKDIVDGKYSQLTSSNLDSKLRED-LERLKKI 382 KI WFL++ K+I+D Y L +++ +L D L R K+I Sbjct: 275 KIDKWFLHKMKNIID-YYLVLENTDHTKQLSHDVLLRAKQI 314 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 24.6 bits (51), Expect = 0.64 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -2 Query: 265 LILPGFDMIVIIFSTSSSVHSPARLSRSMSAFLRTMLEYLRPTPLIAVIANITL 104 L +PG+ MI I F+TS ++ R + + T+ L PT ++ A+ L Sbjct: 541 LCIPGY-MIYIWFTTSGTISEKFRKLIRIEDDVATLRMKLNPTKAASINADFEL 593 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 24.6 bits (51), Expect = 0.64 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -2 Query: 265 LILPGFDMIVIIFSTSSSVHSPARLSRSMSAFLRTMLEYLRPTPLIAVIANITL 104 L +PG+ MI I F+TS ++ R + + T+ L PT ++ A+ L Sbjct: 594 LCIPGY-MIYIWFTTSGTISEKFRKLIRIEDNVATLRMKLNPTKAASINADFEL 646 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 290 QKDIVDGKYSQLTSSNLDSKLREDLERLKKIRA 388 + D + QLTSS +S + D +LK IRA Sbjct: 1781 ESDESESDPDQLTSSRTESSNQLDAGKLKHIRA 1813 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 157 LEYLRPTPLIAVIANITLRL 98 L Y+R P + +A TLRL Sbjct: 519 LPYIRLIPKVTAVAGETLRL 538 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 290 QKDIVDGKYSQLTSSNLDSKLREDLERLKKIRA 388 + D + QLTSS +S + D +LK IRA Sbjct: 1777 ESDESESDPDQLTSSRTESSNQLDAGKLKHIRA 1809 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 157 LEYLRPTPLIAVIANITLRL 98 L Y+R P + +A TLRL Sbjct: 519 LPYIRLIPKVTAVAGETLRL 538 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 22.6 bits (46), Expect = 2.6 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 138 VGRRYSNIVLKKADIDLDKRAGECTEEEVEKIITI 242 +G+R S V K A T +E+EKI T+ Sbjct: 3 LGQRISGAVAVLRGTSEVKEAQTSTSDEIEKITTV 37 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.8 bits (44), Expect = 4.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 274 VWYLILPGFDMIVIIFSTSSSVHSPARLSR 185 VW +L F+ + +IF SS A L R Sbjct: 157 VWVELLKHFNYMKVIFIHSSDTDGRALLGR 186 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 6.0 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = -2 Query: 253 GFDMIVIIFSTSSSVHSPARLSRSMSAFLRTMLEYLRPTPLI 128 G M+V IF ++ S+ +P+ L A ++ + P++ Sbjct: 69 GNGMVVYIFLSTKSLRTPSNLFVINLAISNFLMMFCMSPPMV 110 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 186 DQCRLF*EQCWS 151 D+C EQCWS Sbjct: 829 DECWRLMEQCWS 840 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 186 DQCRLF*EQCWS 151 D+C EQCWS Sbjct: 867 DECWRLMEQCWS 878 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = -2 Query: 268 YLILPGFDMIVIIFSTSSSVHSPARL 191 ++ + G M+V IF ++ S+ +P+ L Sbjct: 30 FVSVMGNGMVVYIFLSTKSLRTPSNL 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,566 Number of Sequences: 438 Number of extensions: 3068 Number of successful extensions: 15 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -