BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30515 (754 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 4.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 6.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 6.0 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 22 6.0 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 8.0 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.2 bits (45), Expect = 4.6 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +3 Query: 522 LTSAGRSSRGLGKGHRYSQTKGGSRRAALLRRNTLQLRRKR*TS 653 L G+ R G+G +YS + G + + ++ +RKR TS Sbjct: 5 LQEFGKRGRSTGRGLKYSGQQHGPQSDSRNQQLRTGEKRKRSTS 48 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 512 DAWSDFGWSQLP 547 D WS F W+ LP Sbjct: 915 DQWSSFYWNLLP 926 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 512 DAWSDFGWSQLP 547 D WS F W+ LP Sbjct: 915 DQWSSFYWNLLP 926 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 97 KTHNIAQFFPIQLLNISVGTHLS 29 + H + FPI L ISV T L+ Sbjct: 386 RQHAVTAKFPIYLYRISVETKLN 408 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +2 Query: 8 ARRLPQAAKMGAY 46 ++R+PQ AK GAY Sbjct: 286 SQRVPQLAKNGAY 298 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,158 Number of Sequences: 336 Number of extensions: 3515 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -