BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30513 (785 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1039.02 |||phosphoprotein phosphatase |Schizosaccharomyces p... 28 1.7 SPBC14C8.02 |tim44||TIM23 translocase complex subunit Tim44|Schi... 27 4.0 SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 27 4.0 SPCC18B5.11c |cds1||replication checkpoint kinase Cds1|Schizosac... 26 5.3 SPAC24C9.02c |||cytochrome c1 heme lyase|Schizosaccharomyces pom... 26 5.3 >SPAC1039.02 |||phosphoprotein phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 27.9 bits (59), Expect = 1.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 297 FASKSRDLRSIKGVELKMANKVYVHDGGKLDE 392 FA + ++L KGV+L M + +HDG L + Sbjct: 79 FALRMKELADFKGVDLLMVDTGDLHDGNGLSD 110 >SPBC14C8.02 |tim44||TIM23 translocase complex subunit Tim44|Schizosaccharomyces pombe|chr 2|||Manual Length = 427 Score = 26.6 bits (56), Expect = 4.0 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = +2 Query: 539 LSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSKDQTIQVPMMYKRGDYKYGESAHL 718 + +AT V A Y K + D +S FY K+Q ++ ++R + + SA + Sbjct: 136 VDTATKPVRETAFY-KTIKQTMSDGSTSSRYGFYADKEQRKKLREEFERRNRMFASSARI 194 Query: 719 MPN 727 PN Sbjct: 195 QPN 197 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 26.6 bits (56), Expect = 4.0 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = -2 Query: 367 TYTLFAILSSTPLIDRRSRLLLANSVRIASSSGKPI 260 TY+ I SS+ L+ S L++++S +ASSS PI Sbjct: 665 TYSSSVIPSSSTLVSSSSSLIVSSS-PVASSSSSPI 699 >SPCC18B5.11c |cds1||replication checkpoint kinase Cds1|Schizosaccharomyces pombe|chr 3|||Manual Length = 460 Score = 26.2 bits (55), Expect = 5.3 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -3 Query: 153 FHYFGKHSGCEVIVS---IFEYIREICDGCHCRDGDSKQTNDCLH 28 F FG+H CEV+++ + + EI G H D D + LH Sbjct: 59 FWRFGRHKSCEVVLNGPRVSNFHFEIYQG-HRNDSDESENVVFLH 102 >SPAC24C9.02c |||cytochrome c1 heme lyase|Schizosaccharomyces pombe|chr 1|||Manual Length = 216 Score = 26.2 bits (55), Expect = 5.3 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 302 REFCSYSIVVREADSFKSSSWVSPSE 225 RE + VV E+DS K W+ PS+ Sbjct: 49 REISTIPKVVTESDSGKEEKWIYPSQ 74 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,137,396 Number of Sequences: 5004 Number of extensions: 63452 Number of successful extensions: 189 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 189 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 381366860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -