BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30512 (628 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0981 + 23266174-23266689,23268389-23268549,23269068-232693... 30 1.7 01_06_1125 + 34683184-34684776 27 9.2 >08_02_0981 + 23266174-23266689,23268389-23268549,23269068-23269309, 23270180-23270284,23270746-23270902,23271860-23272028, 23272598-23272638,23273151-23273216,23273524-23273779 Length = 570 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +1 Query: 310 SARKIVKHIKQHEADYWEQMKAKYD-PKDEFKEIYEGFLAGQN*TCYKCLRWYNRI 474 S K +KHI ++ + + ++ KYD P D FK + + +A + +C C+ +I Sbjct: 374 SIAKTMKHIASNQEAFNQSLRWKYDGPSDSFKALID--MAAVHSSCRLCIHVATKI 427 >01_06_1125 + 34683184-34684776 Length = 530 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/32 (34%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +1 Query: 340 QHEADYWEQMKAK-YDPKDEFKEIYEGFLAGQ 432 + A Y+E+MKAK + P+ + +E+ + +L+G+ Sbjct: 475 EESAKYYEEMKAKGFPPEKKTEEMIQAWLSGR 506 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,111,947 Number of Sequences: 37544 Number of extensions: 292165 Number of successful extensions: 603 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -