BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30512 (628 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY596807-1|AAT42127.1| 634|Homo sapiens sodium-dependent amino ... 33 1.1 AY591756-1|AAT66171.1| 634|Homo sapiens system B0 neutral amino... 33 1.1 >AY596807-1|AAT42127.1| 634|Homo sapiens sodium-dependent amino acid transporter protein. Length = 634 Score = 32.7 bits (71), Expect = 1.1 Identities = 16/52 (30%), Positives = 30/52 (57%) Frame = -1 Query: 181 LSVLKNFINIYVVILVSVLLGNR*ARHE*KCSNC*TLHVCNGFNQHKSDVTQ 26 +S++ F ++YV I+V ++G R + C + L + NGF+ + +VTQ Sbjct: 306 VSIINGFTSVYVAIVVYSVIGFRATQRYDDCFSTNILTLINGFDLPEGNVTQ 357 >AY591756-1|AAT66171.1| 634|Homo sapiens system B0 neutral amino acid transporter protein. Length = 634 Score = 32.7 bits (71), Expect = 1.1 Identities = 16/52 (30%), Positives = 30/52 (57%) Frame = -1 Query: 181 LSVLKNFINIYVVILVSVLLGNR*ARHE*KCSNC*TLHVCNGFNQHKSDVTQ 26 +S++ F ++YV I+V ++G R + C + L + NGF+ + +VTQ Sbjct: 306 VSIINGFTSVYVAIVVYSVIGFRATQRYDDCFSTNILTLINGFDLPEGNVTQ 357 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,541,150 Number of Sequences: 237096 Number of extensions: 1636058 Number of successful extensions: 2866 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2866 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6804036910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -