BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30510 (737 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 2.3 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 2.3 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 6.9 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 6.9 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 6.9 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/34 (23%), Positives = 16/34 (47%) Frame = -1 Query: 722 RLVSETRLSFWVN*SRTARCSFPCAS*IEVPVSP 621 R + ++ W+ + FPC ++PV+P Sbjct: 62 RFKAPQKIPAWIGELSATKFGFPCLQYTQLPVNP 95 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/34 (23%), Positives = 16/34 (47%) Frame = -1 Query: 722 RLVSETRLSFWVN*SRTARCSFPCAS*IEVPVSP 621 R + ++ W+ + FPC ++PV+P Sbjct: 62 RFKAPQKIPAWIGELSATKFGFPCLQYTQLPVNP 95 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 6.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 542 RNFYREKELLHPGYMAWRPSPR 607 R YREK YMA+R PR Sbjct: 385 RRQYREKVKQVEEYMAYRKLPR 406 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 6.9 Identities = 15/74 (20%), Positives = 31/74 (41%) Frame = +3 Query: 69 QRTGSFEKRSPSPDLKRQKPDTKKEKIIKTVYEVEKKISPKPIQEEKPSWVTNRNLKKVT 248 Q T S R S R + KK++ + ++ +KK+ + ++ S R K Sbjct: 225 QHTSSRYSRERSCSRDRNREYKKKDRRYEKLHNEKKKLLEERTSRKRYSRSREREQKSYK 284 Query: 249 SERGVSVRKKLSRK 290 +E ++ S++ Sbjct: 285 NENSYRKYRETSKE 298 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 6.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 542 RNFYREKELLHPGYMAWRPSPR 607 R YREK YMA+R PR Sbjct: 353 RRQYREKVKQVEEYMAYRKLPR 374 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,326 Number of Sequences: 438 Number of extensions: 4837 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -