BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30508 (800 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 68 8e-12 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 54 2e-07 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 52 5e-07 SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) 50 3e-06 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 49 4e-06 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 46 5e-05 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 38 0.013 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 37 0.017 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 36 0.038 SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.067 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 34 0.12 SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.15 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 33 0.20 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 33 0.27 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 32 0.62 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 32 0.62 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 31 1.1 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) 31 1.1 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_2941| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 30 2.5 SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 30 2.5 SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_57208| Best HMM Match : Ion_trans (HMM E-Value=5.5e-34) 29 4.4 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) 29 4.4 SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) 29 4.4 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_25359| Best HMM Match : p450 (HMM E-Value=0) 29 5.8 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 5.8 SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) 28 7.7 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_42035| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 28 7.7 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 28 7.7 SB_7551| Best HMM Match : zf-HIT (HMM E-Value=8.4) 28 7.7 SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) 28 7.7 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 68.1 bits (159), Expect = 8e-12 Identities = 33/87 (37%), Positives = 54/87 (62%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F E++ V DP T RSRGF F+ FK P+++D V+ +G +++D KK Sbjct: 128 FEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGA-----QELDGKKMVTTT 182 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTI 502 KIF+GGLS+ S+++++ +FS+FG + Sbjct: 183 KKIFIGGLSTNTSEEDMKKYFSQFGKV 209 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/26 (34%), Positives = 20/26 (76%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAYVK 260 +K+F+GGLS T++++++ +F + K Sbjct: 183 KKIFIGGLSTNTSEEDMKKYFSQFGK 208 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 54.8 bits (126), Expect = 8e-08 Identities = 32/98 (32%), Positives = 48/98 (48%), Gaps = 5/98 (5%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD-----PKK 406 F EI+ VK DPNT RSRGF F+ FK E V++ H I + + PK+ Sbjct: 135 FTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLST-SHRIQGRLCEVRLPRPKE 193 Query: 407 AKARHGKIFVGGLSSEISDDEIRNFFSEFGTILEWRCP 520 K+FVG L ++ + +F++FG + + P Sbjct: 194 ELNVPKKLFVGRLPESTTEKTLMEYFAQFGEVTDVYIP 231 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 53.6 bits (123), Expect = 2e-07 Identities = 23/75 (30%), Positives = 50/75 (66%), Gaps = 11/75 (14%) Frame = +2 Query: 296 GRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK-----------AKARHGKIFVGG 442 GRSRGF F+ +++ +S+++V+ +H +++++++PK+ A ++ KIFVGG Sbjct: 86 GRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGG 145 Query: 443 LSSEISDDEIRNFFS 487 L+S +++I+ +F+ Sbjct: 146 LASTTVEEDIKEYFN 160 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +2 Query: 257 EIESINVKTD-PNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAK 412 E+ +++K D N R RGFAF+ F E ++KV A H I K+ + KKA+ Sbjct: 170 EVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAE 222 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +1 Query: 526 KTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 K + +GF F+T+ES VN++LK + +E++ KR+ P+ + Sbjct: 83 KRDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDE 128 Score = 36.7 bits (81), Expect = 0.022 Identities = 12/24 (50%), Positives = 20/24 (83%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAY 254 RK+F+GGL+W TT++ L+D+F + Sbjct: 50 RKIFIGGLNWNTTEEGLKDYFSQW 73 Score = 35.1 bits (77), Expect = 0.067 Identities = 14/41 (34%), Positives = 30/41 (73%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 KIF+GGL+ +++ ++++FS++GTI++ C + K+ + R Sbjct: 51 KIFIGGLNWNTTEEGLKDYFSQWGTIVD--CVIMKRDGRSR 89 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/51 (27%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +1 Query: 508 MEMPFDKTKNQR-KGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +++ D+ +R +GF F+TF+++++V + I K+ +VK+A P+ Sbjct: 174 VDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 224 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/23 (39%), Positives = 19/23 (82%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGA 251 RK+FVGGL+ T +++++++F + Sbjct: 139 RKIFVGGLASTTVEEDIKEYFNS 161 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 52.0 bits (119), Expect = 5e-07 Identities = 30/78 (38%), Positives = 40/78 (51%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFV 436 E+ +++K D TGR RGFAF+ FK D + I K R KIFV Sbjct: 54 ELVGVDIKMDALTGRPRGFAFVQFKHQSEADAIDPKPAAPIG------KPPHLRVKKIFV 107 Query: 437 GGLSSEISDDEIRNFFSE 490 GGL E SD++IR +F + Sbjct: 108 GGLKPETSDEKIREYFGK 125 Score = 50.4 bits (115), Expect = 2e-06 Identities = 20/45 (44%), Positives = 32/45 (71%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 + + N+R+GFCF++F+SE V+ + +T I G +V+VKRA PK Sbjct: 138 EHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPK 182 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/41 (48%), Positives = 25/41 (60%) Frame = +3 Query: 132 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 G S D N DD KLFVGGLS+ETT + L+++F Y Sbjct: 12 GTSLDSNKTRMTKDDDIGKLFVGGLSYETTKESLKEYFSKY 52 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/53 (35%), Positives = 32/53 (60%) Frame = +2 Query: 251 IREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 ++EIE I T+ ++ R RGF F+ F + +++DK+ H I KV+ K+A Sbjct: 130 VKEIEYI---TEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRA 179 Score = 34.7 bits (76), Expect = 0.088 Identities = 12/28 (42%), Positives = 22/28 (78%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTIL 505 GK+FVGGLS E + + ++ +FS++G ++ Sbjct: 29 GKLFVGGLSYETTKESLKEYFSKYGELV 56 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFG 248 +K+FVGGL ET+D+++R++FG Sbjct: 103 KKIFVGGLKPETSDEKIREYFG 124 >SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) Length = 343 Score = 49.6 bits (113), Expect = 3e-06 Identities = 26/85 (30%), Positives = 46/85 (54%) Frame = +2 Query: 293 TGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEI 472 +G+S+GFAF+ + E+++ V+ +H I+N V +K + + K+ + + S I + +I Sbjct: 79 SGKSKGFAFVRLRKKEAVESVLGRDDHVIDNSDVSMEK-QDTYRKVILKNIPSSIGESQI 137 Query: 473 RNFFSEFGTILEWRCPLTKQRTKER 547 FS G I P +TKER Sbjct: 138 LEHFSSSGEIASVYIP-ENLKTKER 161 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 49.2 bits (112), Expect = 4e-06 Identities = 29/87 (33%), Positives = 44/87 (50%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F E+ES+ + G SR + F++FK + K + H IN K VD K++ Sbjct: 100 FEQFGEVESVRIMRT-FLGYSRNYGFVLFK-DDGPSKEVLKKSHVINGKTVDVGKSR-NF 156 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTI 502 I+VGGL S ++ +R F +FG I Sbjct: 157 RVIYVGGLPSHFTEQTVREHFKKFGVI 183 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +2 Query: 380 NNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 N+ PK + +FVGGL+S ++ ++++F +FG + Sbjct: 66 NSTLPSPKDIEKNSRSVFVGGLASGTDEEGLKDYFEQFGEV 106 Score = 33.1 bits (72), Expect = 0.27 Identities = 11/46 (23%), Positives = 26/46 (56%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 394 ++ +++ TD TG+S+G + + P +++K++ H I +V Sbjct: 344 QVAKVHILTDRETGKSKGCGVVKLRHPGTVNKILEEPVHVIGKSQV 389 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 21/87 (24%) Frame = +2 Query: 305 RGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---------------------KARH 421 +GF F+ F+ P +I+ V+A H ++ K +DPK A A Sbjct: 142 KGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPRGPGQQAQTGAVMGGPQRGSAND 201 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTI 502 GK+F+GGL+ ++++++ +FS +G + Sbjct: 202 GKVFIGGLAFGTTEEDLKEYFSTYGMV 228 Score = 35.1 bits (77), Expect = 0.067 Identities = 12/29 (41%), Positives = 23/29 (79%) Frame = +3 Query: 168 GRDDDRKLFVGGLSWETTDKELRDHFGAY 254 G +D K+F+GGL++ TT+++L+++F Y Sbjct: 197 GSANDGKVFIGGLAFGTTEEDLKEYFSTY 225 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 F++ KGF F+TF + +L + GK +D K A P+ Sbjct: 134 FERRARMLKGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPR 179 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = +2 Query: 284 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 418 D T R RGF F+ F++ S DK H INNKKV+ KKA+ + Sbjct: 5 DKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/46 (43%), Positives = 27/46 (58%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 FDK + +GF F+TFESE + T I K+V+VK+A PK Sbjct: 4 FDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/94 (25%), Positives = 47/94 (50%), Gaps = 6/94 (6%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNK--KVD---PK 403 F ++ + S + D TG+S G+AF+ + P+ +K V + NK KV P Sbjct: 47 FGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPS 106 Query: 404 KAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 505 + ++ +++ GL ++ ++E+ F FG I+ Sbjct: 107 STEIKNANLYISGLPKDMKEEEVEALFKPFGKII 140 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 12/85 (14%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAAGE-HTINNKKVDPKKAKARHG-- 424 ++ S+++ P G+SR F F+ F + ID ++ E H+I+NK+V+ K+A R Sbjct: 38 DVSSVSLAKTPE-GKSRKFCFVEFSNGSDIIDNIVFNFESHSIDNKQVEVKRAMPRDDPN 96 Query: 425 --------KIFVGGLSSEISDDEIR 475 K+F+GGL E S+++++ Sbjct: 97 ELAHVRTKKLFIGGLKDEHSEEDVK 121 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/49 (34%), Positives = 31/49 (63%) Frame = +1 Query: 502 LRMEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 648 L ++M D+ N+ KG+CF+ F +E +V+ L + GK+V++K+A Sbjct: 133 LEIKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKA 181 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/29 (44%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = +3 Query: 174 DDDR--KLFVGGLSWETTDKELRDHFGAY 254 DD + KLFVGGL+ +TT++ +R +F ++ Sbjct: 3 DDSKLMKLFVGGLNEDTTEETVRAYFKSF 31 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEF 493 K+FVGGL+ + +++ +R +F F Sbjct: 9 KLFVGGLNEDTTEETVRAYFKSF 31 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +2 Query: 269 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 I + D T + +G+ F+ F +DK+ + K V+ KKA Sbjct: 135 IKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKA 181 >SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 40.7 bits (91), Expect = 0.001 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 5/89 (5%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK----AKAR-H 421 EI ++ DP TG ++GFAF F S + + T+N+K + P + K+R + Sbjct: 178 EIREFRLQMDPATGLNKGFAFCTFTEQTSAYQAIT----TLNDKDIRPGRRLAICKSRSN 233 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 ++FV G+ S +EI FS+ T L+ Sbjct: 234 SRLFVKGIPKRKSKEEIFQEFSKVTTDLQ 262 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = +3 Query: 150 NSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 N E D KLFVGGL+ ETT++ LR++F AY Sbjct: 3 NRQENTNNDPRAKLFVGGLNRETTNETLREYFEAY 37 Score = 36.7 bits (81), Expect = 0.022 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 15/93 (16%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVF---KAPESI--DKVMAAGEHTINNKKVDPKK 406 F + E+ + V D T +SRGF ++ F K ++ DKV G H I+ K+V+ K+ Sbjct: 34 FEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKV-ENGAHRIDGKEVEVKR 92 Query: 407 AKARHG----------KIFVGGLSSEISDDEIR 475 A R KIFVGGL + + ++I+ Sbjct: 93 AIPRDDNSATSHEKTKKIFVGGLPEDATKEDIQ 125 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRT----IGGKEVDVKRATPKPD 663 D + +GF ++TF +V ++LK I GKEV+VKRA P+ D Sbjct: 48 DSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDD 98 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 D+TK+ +GF F+ +E ++L K + GK V+ K+ATP+ Sbjct: 147 DETKH--RGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPR 189 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E +++ +R +F +G + + Sbjct: 15 KLFVGGLNRETTNETLREYFEAYGELTD 42 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +2 Query: 263 ESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 E++N+ TD TGR RGF F+ F + E ++K + Sbjct: 123 EAVNIITDRETGRPRGFGFVTFGSKEEMEKAI 154 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGG+ E DD +R FF++FG I E Sbjct: 11 KLFVGGIPYESGDDALRKFFAQFGEIRE 38 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 36.7 bits (81), Expect = 0.022 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 22/102 (21%) Frame = +2 Query: 269 INVKTDPNTGRSRGFAFIVF-------KAPESIDKVMAAGEHTINN---KKVDPKKAKAR 418 + V DP +S+GF F+ F KA +D V G+ N +K +P + K Sbjct: 542 VRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNNPTQTKPL 601 Query: 419 ------------HGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 + ++VG L ++ D E++ FS++G+ILE Sbjct: 602 VWDDVFHQSSQLNTTVYVGNLPPDVKDYELQQMFSQYGSILE 643 Score = 31.9 bits (69), Expect = 0.62 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 523 DKTKNQRKGFCFITF-ESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 D KN+ KGF F++F E + + TIGGK+V A K Sbjct: 547 DPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARK 592 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 35.9 bits (79), Expect = 0.038 Identities = 18/57 (31%), Positives = 33/57 (57%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 427 +I S+ V TDP G+S+GF F+ F+ PE ++ + + +N K++ ++ A K Sbjct: 134 KIVSLKVMTDPE-GKSKGFGFVSFETPEEAEEAV----NVLNGKEIGGRRLWAGRAK 185 >SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 35.5 bits (78), Expect = 0.051 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESI 346 +E++ + TD NTG+ R F F+ F +P S+ Sbjct: 483 LENVRIPTDKNTGQQRSFGFVEFSSPVSV 511 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 35.1 bits (77), Expect = 0.067 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 266 SINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 S+ V TD TGR RGF F+ F + + +DK + Sbjct: 37 SVKVITDRETGRPRGFGFVTFGSEDEMDKAI 67 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/68 (25%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKV---MAAGEHTINNKKVDPKKAKARHGK 427 ++ + V +D T R RGFAF+ F + ++++ + E + KV+ +++ + G Sbjct: 254 DVVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQARSREQRGG 313 Query: 428 IFVGGLSS 451 GG S Sbjct: 314 GRGGGYRS 321 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 ++ + V TD TGR RGF F+ F + E ++K + Sbjct: 29 DVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAI 62 >SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 3/62 (4%) Frame = +2 Query: 335 PESI-DKVMAAGEHTIN-NKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI-L 505 PE++ D+++ + ++N + D + K+FVGGL +I +DEI F FG++ + Sbjct: 313 PENLADQIVPSLASSLNCSPNSDSEHIPRFSRKVFVGGLPPDIDEDEIHASFCRFGSLTV 372 Query: 506 EW 511 +W Sbjct: 373 DW 374 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/90 (23%), Positives = 41/90 (45%), Gaps = 7/90 (7%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVDPKKAKARH----- 421 + ++++ D T +G+ F+ F E D + + K + KA A + Sbjct: 39 VVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAHNKNLDV 98 Query: 422 -GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 +F+G L +E+ + + + FS FG IL+ Sbjct: 99 GANLFIGNLDTEVDEKLLYDTFSAFGVILQ 128 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTIN 382 +++ + D +TG S+GFAFI F + ++ D + A G++ N Sbjct: 127 LQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCN 169 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 ++F+G L S + D ++ FS++GTILE Sbjct: 358 QVFIGNLPSGVKDADVNEVFSKYGTILE 385 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = +2 Query: 386 KKVDPK--KAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 KK+ PK + + G I++G + ++EI+ FF +FGT+ R +K+ + + Sbjct: 84 KKIKPKGDEDELSPGVIYLGHIPHGFFENEIKKFFEQFGTVNRIRLSRSKKSARSK 139 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 31.9 bits (69), Expect = 0.62 Identities = 11/40 (27%), Positives = 24/40 (60%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 +FVG + E S+++++ FSE G ++ +R ++ K + Sbjct: 27 VFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPK 66 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 31.9 bits (69), Expect = 0.62 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 +IFV G + E ++ E+R FF E+G + E Sbjct: 9 RIFVKGFNRETTESELRAFFEEYGVVKE 36 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 171 RDDDRKLFVGGLSWETTDKELRDHFGAY 254 +D +++FV G + ETT+ ELR F Y Sbjct: 4 QDISKRIFVKGFNRETTESELRAFFEEY 31 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVG +S ++++R FS FGTI E Sbjct: 215 KLFVGMISKHAKEEDLRVMFSPFGTIEE 242 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 5/82 (6%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK-----AKARHG 424 I + DP +G ++GFAF F + + ++NK++ P K + Sbjct: 178 IYDFRLMIDPISGLTKGFAFCTFSNKDEAQNAV----KKLDNKEIRPGKRLGVCISVANS 233 Query: 425 KIFVGGLSSEISDDEIRNFFSE 490 ++FVG + S EI FS+ Sbjct: 234 RLFVGSIPKTKSKQEILEEFSK 255 >SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) Length = 145 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +2 Query: 293 TGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV--DPK 403 TG+S+GF ++ ++ ES + + AG H I+ K V +PK Sbjct: 99 TGKSKGFGYVTYENAESAQRAL-AGTHIIDGKWVIAEPK 136 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESI 346 +E +++ D +GRSRGF F++ ++ + I Sbjct: 34 VEKVDILRDKESGRSRGFGFVLLQSADQI 62 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTI 502 KIF+GGL + +++D+++ S FG + Sbjct: 674 KIFIGGLPNYLNEDQVKELLSSFGEL 699 >SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 66 NDNFAQDITTDNQLNGNAENGGGDSQDH-NSAEAPGRDDD 182 ND+ DI D+ NGN + G D+ D N E G DDD Sbjct: 20 NDDDGDDIDDDDG-NGNGNDNGDDNDDDDNDDEGNGDDDD 58 >SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 30.7 bits (66), Expect = 1.4 Identities = 21/70 (30%), Positives = 34/70 (48%) Frame = -3 Query: 369 SPAAMTLSIDSGALNTMKANPRDLPVFGSVFTLILSISRMLQNDHGAPYLWSPSSAHQQK 190 SP A++ +D G +A +++P F TL L + G P ++PSS H++ Sbjct: 371 SPDALSKGLDMGWGALSRAGVQEMPAFP---TLRLPLHPFASTGFGTPAFYNPSSYHRE- 426 Query: 189 VFCRHRVLGP 160 + VLGP Sbjct: 427 ---YYPVLGP 433 >SB_2941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAE----NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKE 230 +ND D D+++NG + N GGD D + + DDD + G S++ D + Sbjct: 58 DNDGGDDDDDDDDEVNGGNDDDDFNNGGDCDDDDDDDDDDDDDDDDINKKGASYDDDDDD 117 Query: 231 LRDHF 245 D + Sbjct: 118 DDDGY 122 >SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 621 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 251 IREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 I I+ + K+ N G++ G AF+VFK+ K + I ++ ++ Sbjct: 358 IASIDLLKHKSGKNQGKNTGVAFVVFKSNNDASKALKMDRSYIGHRYIE 406 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/76 (25%), Positives = 35/76 (46%) Frame = +2 Query: 275 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSE 454 V +P G SRGFAF+ + E +K G+ N ++V+ + +G G + Sbjct: 237 VAINPANGGSRGFAFVDYATAEEAEK----GQRAHNGRQVEGSNIRVAYGS--PGRTGAS 290 Query: 455 ISDDEIRNFFSEFGTI 502 I ++ N + + T+ Sbjct: 291 ILGSQLDNTQAGYTTV 306 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 189 LFVGGLSWETTDKELRDHF 245 L+VGGL + T+++LRDHF Sbjct: 306 LYVGGLEGKVTEQDLRDHF 324 Score = 28.3 bits (60), Expect = 7.7 Identities = 8/25 (32%), Positives = 19/25 (76%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTI 502 ++VGGL ++++ ++R+ F +FG + Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFGEL 330 >SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 8/59 (13%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKL--------FVGGLSWE 215 NN+N D +DN + N++N ++ D+N+ R D ++ ++ GL+WE Sbjct: 613 NNNNNNNDNNSDNNSDNNSDNNSDNNSDNNNDNNSERGADPEIKRGKNPEGWIRGLNWE 671 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/75 (17%), Positives = 34/75 (45%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F + +ES+ + D TG +GF +++F++ +++ + +K+ +K + Sbjct: 76 FTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNNAEFKGRKIRVFPSKDKP 135 Query: 422 GKIFVGGLSSEISDD 466 F+ + D+ Sbjct: 136 QTEFISHIQVRFRDN 150 >SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 182 NN+N + +N N N N ++ D NS E DDD Sbjct: 18 NNNNNNNNNNNNNNNNNNNNNNNNNNNDDNSDEDDDDDDD 57 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 ++++++ TD SRGFA++ + PE +K + Sbjct: 1183 VKTVDLPTDRTNNLSRGFAYVEYVDPEECEKAL 1215 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/50 (26%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 508 MEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTPKRTIGGKEVDVKRATP 654 +++P D+T N +GF ++ + + E+ L I G+E+ V+ P Sbjct: 1186 VDLPTDRTNNLSRGFAYVEYVDPEECEKALKHMDGGQIDGQEIAVQSVLP 1235 >SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/56 (25%), Positives = 29/56 (51%) Frame = +2 Query: 383 NKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKERA 550 +K + K + K+FVG + ++ E+++FF FG ++ + R K+R+ Sbjct: 66 SKDISKYKVVSNKCKVFVGNIGFKVRARELKDFFGYFGDVV--YAQIIMDRVKKRS 119 >SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAE-NGGGDSQDHNS 155 NND+ D T D+ N N + NGGG D+N+ Sbjct: 193 NNDDDDDDDTDDDDHNNNDDDNGGGGDDDNNN 224 >SB_57208| Best HMM Match : Ion_trans (HMM E-Value=5.5e-34) Length = 722 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = -3 Query: 381 LMVCSPAAMTLSIDSGALNTMKANPRDLPVF-GSVFTLILSISRMLQNDHGAPYLWSPSS 205 L + P+A++ +I K P LPV G+ +T S +N H YLW Sbjct: 525 LPITFPSAVSGTISPYLDIVNKYTPHGLPVVRGNEYTPHGSPVARGKNTHKTGYLWPRER 584 Query: 204 AHQQKVFCRH 175 H +V C H Sbjct: 585 IHTTRVTCCH 594 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +3 Query: 66 NDNFAQDITTDNQLN-GNAENGGGDSQDHNS 155 +DNF DI+ D LN G A N + ++NS Sbjct: 335 HDNFNDDISNDGNLNGGGANNNNNKNNNYNS 365 >SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) Length = 189 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 182 NN+N +I +N N N N ++ ++N+ + DDD Sbjct: 112 NNNNNNNNINNNNNNNNNNNNNNNNNNNNNNNDDDDDDDD 151 >SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) Length = 244 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 60 ANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 182 A N+ +A+ +T +N N N N ++ ++N+ DDD Sbjct: 160 AINEKYAKIMTDNNNNNNNNNNNNNNNNNNNNNNNNNNDDD 200 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 28.7 bits (61), Expect = 5.8 Identities = 9/33 (27%), Positives = 22/33 (66%) Frame = +1 Query: 505 RMEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 603 ++++ +D + Q KGFCF+T +++ + ++T Sbjct: 303 KVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQT 335 >SB_25359| Best HMM Match : p450 (HMM E-Value=0) Length = 1084 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = -3 Query: 264 SISRMLQNDHGAPYLWSPSSAHQQKVFCRHRVLGPQHCYDLANHRHRSL 118 SIS + ++ G P L+ P A Q ++ CR + LG + L ++H S+ Sbjct: 498 SISSIYLHNFGPPVLFEPQKA-QPQLSCRIKTLGTRLASILIVYKHMSV 545 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPES 343 + + V TD TGR RGF F+ +A ++ Sbjct: 107 VVDVRVITDRETGRPRGFGFVTLEAKKT 134 >SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 182 ++DN D DN NG+ ++ D D + +A DDD Sbjct: 61 DSDNNYDDNDDDNDDNGDDDDNDDDDDDDDDDDADDDDDD 100 >SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 69 DNFAQDITTDNQLNGNAENGG-GDSQDHNSAEAPGRDDD 182 D + D D+ + + +N G GD D+ AE G DDD Sbjct: 821 DYYYDDDDDDDDDDDDGDNDGDGDGDDYGDAENYGEDDD 859 >SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) Length = 599 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/30 (30%), Positives = 22/30 (73%) Frame = +3 Query: 66 NDNFAQDITTDNQLNGNAENGGGDSQDHNS 155 ND+ A D++ ++ + G+ +NGG D+ ++++ Sbjct: 180 NDDSASDVSIEDIIYGDDDNGGDDNDNYDN 209 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 395 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 DPK + +FVG L + IS ++R F +FG +L+ Sbjct: 232 DPKATRT----LFVGNLETGISCQDLRLSFEKFGVVLD 265 >SB_42035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -1 Query: 185 SVVIASWGLSTVMILRITATVLCISIKLV 99 ++++ S G++ L ITAT+LC SI L+ Sbjct: 267 TILLESSGVTLPKALHITATILCYSISLL 295 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +3 Query: 123 NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRD 239 NGG + D + A R++ +LFV GL E ++ +LR+ Sbjct: 603 NGGKSTDDASDAAYELRNEGVELFVVGLGDENSEAQLRE 641 >SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) Length = 672 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 +IF G L SE++D+ + F+++ + L+ + K+ K + Sbjct: 218 RIFCGDLGSEVTDESLTRAFAKYTSFLKAKIVRDKKSNKSK 258 >SB_7551| Best HMM Match : zf-HIT (HMM E-Value=8.4) Length = 243 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 600 DSQKNNWWKGGRCEACNTKTRWPRRHRHAK 689 D K+ WW R E C K + R+H+H K Sbjct: 74 DIVKSVWW-WRRLEKCKPKKKRKRKHKHTK 102 >SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) Length = 691 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQD 146 +++++A D DN +NG+ ++GGGD D Sbjct: 585 DDEDYAGD--GDNDVNGDGDSGGGDDDD 610 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,757,925 Number of Sequences: 59808 Number of extensions: 466785 Number of successful extensions: 2982 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 1524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2781 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -