BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30508 (800 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 65 4e-11 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 65 4e-11 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 58 9e-09 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 57 1e-08 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 54 1e-07 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 54 1e-07 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 54 1e-07 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 53 2e-07 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 53 2e-07 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 52 4e-07 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 50 1e-06 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 50 2e-06 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 50 2e-06 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 49 3e-06 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 38 1e-05 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 47 1e-05 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 39 5e-05 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 44 9e-05 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 44 9e-05 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 41 8e-04 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 41 8e-04 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 41 0.001 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 33 0.001 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 40 0.001 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 40 0.002 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 40 0.003 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 40 0.003 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 40 0.003 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 40 0.003 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 39 0.003 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 39 0.004 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 39 0.004 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 39 0.004 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 33 0.006 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 38 0.006 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 38 0.006 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 38 0.008 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 38 0.008 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 38 0.008 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 38 0.010 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 37 0.014 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 37 0.014 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 37 0.018 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 36 0.024 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 36 0.031 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 36 0.031 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 36 0.041 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 36 0.041 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 35 0.055 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 35 0.072 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 35 0.072 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 34 0.096 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 34 0.096 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 34 0.13 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 34 0.13 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 34 0.13 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 34 0.13 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 34 0.13 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 34 0.13 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 34 0.13 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 33 0.17 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 33 0.17 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 33 0.17 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 33 0.17 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 33 0.17 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 33 0.17 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 33 0.17 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 33 0.22 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 33 0.22 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 33 0.22 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 33 0.22 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 33 0.29 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 32 0.39 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 32 0.39 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 32 0.39 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 32 0.39 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 32 0.39 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 32 0.39 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 32 0.39 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 32 0.51 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 32 0.51 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 32 0.51 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 32 0.51 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 32 0.51 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 32 0.51 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 32 0.51 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 31 0.67 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 31 0.67 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 31 0.89 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 31 0.89 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 31 0.89 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 31 0.89 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 31 1.2 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 31 1.2 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 31 1.2 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 30 1.6 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 30 1.6 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 30 1.6 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 30 1.6 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 30 1.6 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 30 1.6 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 30 1.6 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 30 1.6 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 30 1.6 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 30 1.6 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 30 1.6 At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein ... 30 1.6 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 30 1.6 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 30 2.1 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 30 2.1 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 30 2.1 At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein ... 30 2.1 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 30 2.1 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 30 2.1 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 30 2.1 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 30 2.1 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 30 2.1 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 30 2.1 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 30 2.1 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 30 2.1 At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing ... 29 2.7 At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing ... 29 2.7 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 2.7 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 29 2.7 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 29 2.7 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 29 2.7 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 29 3.6 At2g47390.1 68415.m05915 expressed protein 29 3.6 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 29 3.6 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 29 3.6 At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) famil... 29 4.7 At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) famil... 29 4.7 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 29 4.7 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 29 4.7 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 29 4.7 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 28 6.3 At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing ... 28 6.3 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 28 6.3 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 28 6.3 At2g33440.1 68415.m04099 splicing factor family protein similar ... 28 6.3 At1g62170.1 68414.m07013 serpin family protein / serine protease... 28 6.3 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 28 6.3 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 28 6.3 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 28 6.3 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 28 6.3 At5g22830.1 68418.m02669 magnesium transporter CorA-like family ... 28 8.3 At3g21100.1 68416.m02667 RNA recognition motif (RRM)-containing ... 28 8.3 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 28 8.3 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 65.3 bits (152), Expect = 4e-11 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 11/100 (11%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--KA 415 F EI + D +TG+ RGF FI F P +DKV+ H IN K+V+ K+ K Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPKG 97 Query: 416 RHG---------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 G KIFVGG+ S +++DE+++FF+++G ++E Sbjct: 98 AGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVE 137 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 6/77 (7%) Frame = +2 Query: 284 DPNTGRSRGFAFIVFKAPESIDKVMAAG------EHTINNKKVDPKKAKARHGKIFVGGL 445 D T RSRGF F++F + E +D++++ G + + KK +PKK+ R + Sbjct: 143 DHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKKSLNRSPPSYGSHP 202 Query: 446 SSEISDDEIRNFFSEFG 496 S+D ++ +G Sbjct: 203 RGRSSNDSYASYGGPYG 219 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 D+ Q +GF FITF VV+ +++ I GK+V++KR PK Sbjct: 53 DRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK 96 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/55 (34%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +1 Query: 496 NYLRMEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPK 657 N + ++ D N+ +GF F+ F+SE+VV++LL K + +V++K+A PK Sbjct: 134 NVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPK 188 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 129 GGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 G S++ N G K+F+GGL +TT+ HFG Y Sbjct: 2 GSRSRNDNFQSGDGASPG-KIFIGGLHKDTTNTVFNKHFGKY 42 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAY 254 +K+FVGG+ T+ EL+D F Y Sbjct: 109 KKIFVGGIPSTVTEDELKDFFAKY 132 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 413 ARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 A GKIF+GGL + ++ F ++G I + Sbjct: 16 ASPGKIFIGGLHKDTTNTVFNKHFGKYGEITD 47 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 65.3 bits (152), Expect = 4e-11 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 11/100 (11%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--KA 415 F EI + D +TG+ RGF FI F P +DKV+ H IN K+V+ K+ K Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPKG 97 Query: 416 RHG---------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 G KIFVGG+ S +++DE+++FF+++G ++E Sbjct: 98 AGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVE 137 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 D+ Q +GF FITF VV+ +++ I GK+V++KR PK Sbjct: 53 DRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK 96 Score = 33.9 bits (74), Expect = 0.13 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +2 Query: 284 DPNTGRSRGFAFIVFKAPESIDKVMAAG 367 D T RSRGF F++F + E +D++++ G Sbjct: 143 DHETNRSRGFGFVIFDSEEVVDELLSKG 170 Score = 31.1 bits (67), Expect = 0.89 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = +1 Query: 496 NYLRMEMPFDKTKNQRKGFCFITFESEQVVNDLL 597 N + ++ D N+ +GF F+ F+SE+VV++LL Sbjct: 134 NVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELL 167 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 129 GGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 G S++ N G K+F+GGL +TT+ HFG Y Sbjct: 2 GSRSRNDNFQSGDGASPG-KIFIGGLHKDTTNTVFNKHFGKY 42 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAY 254 +K+FVGG+ T+ EL+D F Y Sbjct: 109 KKIFVGGIPSTVTEDELKDFFAKY 132 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 413 ARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 A GKIF+GGL + ++ F ++G I + Sbjct: 16 ASPGKIFIGGLHKDTTNTVFNKHFGKYGEITD 47 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 57.6 bits (133), Expect = 9e-09 Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 12/101 (11%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPK------ 403 F E+ + TD TG RGF F+ F +KV+ +H I+++KVD K Sbjct: 86 FGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLEE-DHVIDDRKVDLKRTLPRG 144 Query: 404 ------KAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 KA ++ KIFVGGL + +DE++N+F +G I+E Sbjct: 145 DKDTDIKAVSKTRKIFVGGLPPLLEEDELKNYFCVYGDIIE 185 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/46 (39%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = +2 Query: 284 DPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKAR 418 D +TGRSRGF F+ F+ +S+D++ + G+ H + +K+V+ K+A+ + Sbjct: 191 DHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPK 236 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = +1 Query: 511 EMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPK 657 ++ +D + +GF F+TF++E V+ L K +G K+V++KRA PK Sbjct: 187 QIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPK 236 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 5/60 (8%) Frame = +3 Query: 90 TTDNQLNGNA--ENGG---GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 T D++ NG A + GG S DH + + KLFVGG+SWETT + ++FG + Sbjct: 31 TFDDRRNGGAAVDTGGIQMKHSVDHRHSSS-SMSSPGKLFVGGVSWETTAETFANYFGKF 89 Score = 33.5 bits (73), Expect = 0.17 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GK+FVGG+S E + + N+F +FG +++ Sbjct: 66 GKLFVGGVSWETTAETFANYFGKFGEVVD 94 Score = 31.1 bits (67), Expect = 0.89 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 D+ +GF F+TF V +L+ I ++VD+KR P+ D Sbjct: 100 DRITGNPRGFGFVTFADSAVAEKVLE-EDHVIDDRKVDLKRTLPRGD 145 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 57.2 bits (132), Expect = 1e-08 Identities = 34/98 (34%), Positives = 48/98 (48%), Gaps = 9/98 (9%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F EI + D TG+ RGF F+ + +DKV+ H I K+V+ K+ R Sbjct: 62 FGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPRG 120 Query: 422 G---------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVGG+ S + DDE + FF +FG + E Sbjct: 121 SMSSNDFKTKKIFVGGIPSSVDDDEFKEFFMQFGELKE 158 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/60 (30%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH-TINNKKVDPKKAKAR 418 F E++ + D +TGRSRGF F+ +++ + +D ++A G ++ +V+ KKA+ + Sbjct: 150 FMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKR-TIGGKEVDVKRATPK 657 D + + +GF F+T+ESE +V+ LL R + G +V++K+A PK Sbjct: 164 DHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 38.3 bits (85), Expect = 0.006 Identities = 22/58 (37%), Positives = 30/58 (51%) Frame = +3 Query: 81 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 +D D + + + E+ SQ H+ G D K+FVGGL+ ETT E HFG Y Sbjct: 11 EDEIHDPKPSEDIEDDDDKSQPHSGG---GVDSAGKIFVGGLARETTSAEFLKHFGKY 65 Score = 34.3 bits (75), Expect = 0.096 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 D+ Q +GF F+T+ VV+ +++ I GK+V++KR P+ Sbjct: 76 DRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPR 119 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GKIFVGGL+ E + E F ++G I + Sbjct: 42 GKIFVGGLARETTSAEFLKHFGKYGEITD 70 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 54.0 bits (124), Expect = 1e-07 Identities = 39/108 (36%), Positives = 58/108 (53%), Gaps = 25/108 (23%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR------- 418 +E++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 33 VEAV-IMRDRATGRARGFGFIVFADPCVSERVIM-DKHIIDGRTVEAKKAVPRDDQQVLK 90 Query: 419 ------------HG------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 HG KIFVGGL S I+++E +N+F +FGTI + Sbjct: 91 RHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIAD 138 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/50 (40%), Positives = 30/50 (60%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 136 IADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FITF+S+ V+ +L + GK V+VKRA PK Sbjct: 143 YDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPK 188 Score = 37.9 bits (84), Expect = 0.008 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GG+SW+T ++ LRD+F Y Sbjct: 7 KLFIGGISWDTDEERLRDYFSNY 29 Score = 36.3 bits (80), Expect = 0.024 Identities = 11/29 (37%), Positives = 23/29 (79%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GK+F+GG+S + ++ +R++FS +G ++E Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYGDVVE 34 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 54.0 bits (124), Expect = 1e-07 Identities = 39/108 (36%), Positives = 58/108 (53%), Gaps = 25/108 (23%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR------- 418 +E++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 33 VEAV-IMRDRATGRARGFGFIVFADPCVSERVIM-DKHIIDGRTVEAKKAVPRDDQQVLK 90 Query: 419 ------------HG------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 HG KIFVGGL S I+++E +N+F +FGTI + Sbjct: 91 RHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIAD 138 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/50 (40%), Positives = 30/50 (60%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 136 IADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FITF+S+ V+ +L + GK V+VKRA PK Sbjct: 143 YDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPK 188 Score = 37.9 bits (84), Expect = 0.008 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GG+SW+T ++ LRD+F Y Sbjct: 7 KLFIGGISWDTDEERLRDYFSNY 29 Score = 36.3 bits (80), Expect = 0.024 Identities = 11/29 (37%), Positives = 23/29 (79%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GK+F+GG+S + ++ +R++FS +G ++E Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYGDVVE 34 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 54.0 bits (124), Expect = 1e-07 Identities = 39/108 (36%), Positives = 58/108 (53%), Gaps = 25/108 (23%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR------- 418 +E++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 33 VEAV-IMRDRATGRARGFGFIVFADPCVSERVIM-DKHIIDGRTVEAKKAVPRDDQQVLK 90 Query: 419 ------------HG------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 HG KIFVGGL S I+++E +N+F +FGTI + Sbjct: 91 RHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIAD 138 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/50 (40%), Positives = 30/50 (60%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 136 IADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FITF+S+ V+ +L + GK V+VKRA PK Sbjct: 143 YDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPK 188 Score = 37.9 bits (84), Expect = 0.008 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GG+SW+T ++ LRD+F Y Sbjct: 7 KLFIGGISWDTDEERLRDYFSNY 29 Score = 36.3 bits (80), Expect = 0.024 Identities = 11/29 (37%), Positives = 23/29 (79%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GK+F+GG+S + ++ +R++FS +G ++E Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYGDVVE 34 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 53.2 bits (122), Expect = 2e-07 Identities = 36/110 (32%), Positives = 55/110 (50%), Gaps = 21/110 (19%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F S E+ + D TGR+RGF F+VF P ++V+ +H I+ K V+ KKA R Sbjct: 26 FHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRD 84 Query: 422 G---------------------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVGGL+S +++ E + +F++FG I + Sbjct: 85 DHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITD 134 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 132 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKERA 550 K+F+GG+S E S+D +R++F FG +LE + K R RA Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLE--AVIMKDRATGRA 46 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/46 (36%), Positives = 29/46 (63%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 139 YDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 37.9 bits (84), Expect = 0.008 Identities = 13/23 (56%), Positives = 20/23 (86%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GG+SWET++ LRD+F ++ Sbjct: 7 KLFIGGISWETSEDRLRDYFHSF 29 Score = 31.5 bits (68), Expect = 0.67 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 162 APGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 +PG + +K+FVGGL+ T+ E + +F + Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFKKYFAQF 129 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 53.2 bits (122), Expect = 2e-07 Identities = 36/110 (32%), Positives = 55/110 (50%), Gaps = 21/110 (19%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F S E+ + D TGR+RGF F+VF P ++V+ +H I+ K V+ KKA R Sbjct: 26 FHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRD 84 Query: 422 G---------------------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVGGL+S +++ E + +F++FG I + Sbjct: 85 DHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITD 134 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 132 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKERA 550 K+F+GG+S E S+D +R++F FG +LE + K R RA Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLE--AVIMKDRATGRA 46 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/46 (36%), Positives = 29/46 (63%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 139 YDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 37.9 bits (84), Expect = 0.008 Identities = 13/23 (56%), Positives = 20/23 (86%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GG+SWET++ LRD+F ++ Sbjct: 7 KLFIGGISWETSEDRLRDYFHSF 29 Score = 31.5 bits (68), Expect = 0.67 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 162 APGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 +PG + +K+FVGGL+ T+ E + +F + Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFKKYFAQF 129 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 52.0 bits (119), Expect = 4e-07 Identities = 34/114 (29%), Positives = 55/114 (48%), Gaps = 25/114 (21%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F + E+ V D TGR RGF F++F P +D+V+ +H+I+ ++VD K+A +R Sbjct: 26 FTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKRAMSRE 84 Query: 422 -------------------------GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVGGL ++D+E R +F +G + + Sbjct: 85 EQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFEVYGPVTD 138 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/46 (41%), Positives = 31/46 (67%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D+ N+ +GF F++F+SE V+ +L + GK+V+VKRA PK Sbjct: 143 YDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPK 188 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +3 Query: 177 DDRKLFVGGLSWETTDKELRDHFGAY 254 D KLFVGG+SWET + +LR+HF Y Sbjct: 4 DQGKLFVGGISWETDEDKLREHFTNY 29 Score = 34.3 bits (75), Expect = 0.096 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTI 502 GK+FVGG+S E +D++R F+ +G + Sbjct: 6 GKLFVGGISWETDEDKLREHFTNYGEV 32 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/47 (36%), Positives = 28/47 (59%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 DK + +GF F+ F V++ +L+ K +I +EVDVKRA + + Sbjct: 40 DKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKRAMSREE 85 Score = 31.1 bits (67), Expect = 0.89 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +3 Query: 81 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRD---DDRKLFVGGLSWETTDKELRDHFGA 251 +++ ++ + G + + N++ + G D +K+FVGGL TD+E R +F Sbjct: 73 REVDVKRAMSREEQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFEV 132 Query: 252 Y 254 Y Sbjct: 133 Y 133 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 50.4 bits (115), Expect = 1e-06 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 25/112 (22%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F + E+ + V + TGR RGF F+ F P ID+V+ +H I+N+ VD K+A +R Sbjct: 26 FSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVL-QDKHHIDNRDVDVKRAMSRE 84 Query: 422 -------------------------GKIFVGGLSSEISDDEIRNFFSEFGTI 502 KIFVGGL ++ DE R +F +G + Sbjct: 85 EQSPAGRSGTFNASRNFDSGANVRTKKIFVGGLPPALTSDEFRAYFETYGPV 136 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/45 (42%), Positives = 30/45 (66%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 D+T + +GF F++F+SE V+ +L + GK+V+VKRA PK Sbjct: 144 DQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRALPK 188 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +2 Query: 275 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 + D T R RGF F+ F + +S+D V+ H +N K+V+ K+A Sbjct: 141 IMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRA 185 Score = 35.5 bits (78), Expect = 0.041 Identities = 12/29 (41%), Positives = 22/29 (75%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GK+F+GG+S + ++ +R +FS FG +L+ Sbjct: 6 GKLFIGGISWDTDENLLREYFSNFGEVLQ 34 Score = 34.7 bits (76), Expect = 0.072 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 177 DDRKLFVGGLSWETTDKELRDHFGAY 254 D KLF+GG+SW+T + LR++F + Sbjct: 4 DQGKLFIGGISWDTDENLLREYFSNF 29 Score = 31.9 bits (69), Expect = 0.51 Identities = 16/54 (29%), Positives = 31/54 (57%) Frame = +1 Query: 502 LRMEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 L++ + +K + +GF F+ F V++ +L+ K I ++VDVKRA + + Sbjct: 33 LQVTVMREKATGRPRGFGFVAFSDPAVIDRVLQD-KHHIDNRDVDVKRAMSREE 85 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 50.0 bits (114), Expect = 2e-06 Identities = 33/109 (30%), Positives = 53/109 (48%), Gaps = 23/109 (21%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---- 409 F S E+ + D TGR+RGF F+VF P ++ +++ +H I+ + V+ KKA Sbjct: 26 FSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPRD 84 Query: 410 -------------------KARHGKIFVGGLSSEISDDEIRNFFSEFGT 499 R KIFVGGL S +++ + + +F +FGT Sbjct: 85 DQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGT 133 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FIT++SE+ V +L + GK V+VKRA PK Sbjct: 141 YDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPK 186 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/44 (36%), Positives = 30/44 (68%) Frame = +2 Query: 419 HGKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKERA 550 +GK+F+GG+S + +++ ++ +FS FG ++E + K RT RA Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFGEVIE--AVILKDRTTGRA 46 Score = 37.5 bits (83), Expect = 0.010 Identities = 11/28 (39%), Positives = 23/28 (82%) Frame = +3 Query: 171 RDDDRKLFVGGLSWETTDKELRDHFGAY 254 + D+ KLF+GG+SW+T ++ L+++F ++ Sbjct: 2 QSDNGKLFIGGISWDTNEERLKEYFSSF 29 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 114 NAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 245 N N S S PGR RK+FVGGL T+ + + +F Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYF 128 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 50.0 bits (114), Expect = 2e-06 Identities = 33/109 (30%), Positives = 53/109 (48%), Gaps = 23/109 (21%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---- 409 F S E+ + D TGR+RGF F+VF P ++ +++ +H I+ + V+ KKA Sbjct: 26 FSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPRD 84 Query: 410 -------------------KARHGKIFVGGLSSEISDDEIRNFFSEFGT 499 R KIFVGGL S +++ + + +F +FGT Sbjct: 85 DQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGT 133 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FIT++SE+ V +L + GK V+VKRA PK Sbjct: 141 YDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPK 186 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/44 (36%), Positives = 30/44 (68%) Frame = +2 Query: 419 HGKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKERA 550 +GK+F+GG+S + +++ ++ +FS FG ++E + K RT RA Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFGEVIE--AVILKDRTTGRA 46 Score = 37.5 bits (83), Expect = 0.010 Identities = 11/28 (39%), Positives = 23/28 (82%) Frame = +3 Query: 171 RDDDRKLFVGGLSWETTDKELRDHFGAY 254 + D+ KLF+GG+SW+T ++ L+++F ++ Sbjct: 2 QSDNGKLFIGGISWDTNEERLKEYFSSF 29 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 114 NAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 245 N N S S PGR RK+FVGGL T+ + + +F Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYF 128 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 49.2 bits (112), Expect = 3e-06 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 9/97 (9%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH----- 421 ++E V D +TGRSRGF ++ F + E + GEH + N+ ++ K A + Sbjct: 28 DLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL-KGEHFLGNRILEVKVATPKEEMRQP 86 Query: 422 ----GKIFVGGLSSEISDDEIRNFFSEFGTILEWRCP 520 +IFV + S +S+ + R+ F +G I + P Sbjct: 87 AKKVTRIFVARIPSSVSESDFRSHFERYGEITDLYMP 123 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/50 (46%), Positives = 27/50 (54%) Frame = +1 Query: 514 MPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 MP D Q +G FITF S V DL++ +GG V V RATPK D Sbjct: 122 MPKDYNSKQHRGIGFITFSSADSVEDLME-DTHDLGGTTVAVDRATPKED 170 Score = 35.1 bits (77), Expect = 0.055 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 KIFVG L E S D++R++F FG I + P +R+ R Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHR 281 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 D++ + +GF ++TF S + + LK + +G + ++VK ATPK + Sbjct: 37 DRSTGRSRGFGYVTFASAEDAKNALK-GEHFLGNRILEVKVATPKEE 82 Score = 31.1 bits (67), Expect = 0.89 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +1 Query: 514 MPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATP 654 +P D ++ +GF F+TF +E V D + I G+EV + ATP Sbjct: 271 IPKDPKRSGHRGFGFVTF-AENGVADRVARRSHEICGQEVAIDSATP 316 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 147 HNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 + E R K+FVG L E + +LRD+FG + Sbjct: 228 YGRGEPTTRGIGNKIFVGRLPQEASVDDLRDYFGRF 263 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 37.9 bits (84), Expect(2) = 1e-05 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Frame = +2 Query: 341 SIDKVMAAGEHTINNKKV--DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILEWR 514 S V+ AG H N ++ + IFVGG+ ++ D+++R FS+FG ++ + Sbjct: 292 SSQAVILAGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGEVVSVK 351 Query: 515 CPLTK 529 P+ K Sbjct: 352 IPVGK 356 Score = 29.1 bits (62), Expect(2) = 1e-05 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVF 328 ++S V D NTGRS+G+ F+ F Sbjct: 229 VKSAKVVIDSNTGRSKGYGFVRF 251 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 47.2 bits (107), Expect = 1e-05 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 27/110 (24%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE----HTINNKKVDPKKAK----- 412 +E++ + D TGR+RGF FIVF P ++V+ T+ KK P+ + Sbjct: 42 VEAV-IMRDRTTGRARGFGFIVFADPSVAERVIMDKHIIDGRTVEAKKAVPRDDQQVLKR 100 Query: 413 ------------------ARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 AR KIFVGGL S I++ E +N+F +FGTI + Sbjct: 101 HASPMHLISPSHGGNGGGARTKKIFVGGLPSSITEAEFKNYFDQFGTIAD 150 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/50 (44%), Positives = 29/50 (58%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 I + V D NT R RGF FI F + ES+D V+ H +N K V+ K+A Sbjct: 148 IADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRA 197 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/46 (43%), Positives = 29/46 (63%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FITF+SE+ V+ +L + GK V+VKRA PK Sbjct: 155 YDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAVPK 200 Score = 37.5 bits (83), Expect = 0.010 Identities = 12/23 (52%), Positives = 20/23 (86%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GG+SW+T ++ L+++FG Y Sbjct: 16 KLFIGGISWDTDEERLQEYFGKY 38 Score = 34.3 bits (75), Expect = 0.096 Identities = 13/43 (30%), Positives = 28/43 (65%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKERA 550 GK+F+GG+S + ++ ++ +F ++G ++E + + RT RA Sbjct: 15 GKLFIGGISWDTDEERLQEYFGKYGDLVE--AVIMRDRTTGRA 55 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 D+T + +GF FI F V ++ K I G+ V+ K+A P+ D Sbjct: 49 DRTTGRARGFGFIVFADPSVAERVI-MDKHIIDGRTVEAKKAVPRDD 94 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 D N+ +GF F+T++SE V ++++ + K V+VKRA PK Sbjct: 154 DGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEVKRAIPK 198 Score = 36.7 bits (81), Expect = 0.018 Identities = 12/28 (42%), Positives = 22/28 (78%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGG++ E S++ ++ +FS +G +LE Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYGAVLE 34 Score = 35.5 bits (78), Expect(2) = 5e-05 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +2 Query: 413 ARHGKIFVGGLSSEISDDEIRNFFSEFG 496 +R KIFVGGLSS +++E +++F FG Sbjct: 117 SRTKKIFVGGLSSNTTEEEFKSYFERFG 144 Score = 31.1 bits (67), Expect = 0.89 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +3 Query: 174 DDDR-KLFVGGLSWETTDKELRDHFGAY 254 D DR KLFVGG++ ET+++ L+ +F Y Sbjct: 2 DYDRYKLFVGGIAKETSEEALKQYFSRY 29 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHF 245 +K+FVGGLS TT++E + +F Sbjct: 120 KKIFVGGLSSNTTEEEFKSYF 140 Score = 29.1 bits (62), Expect(2) = 5e-05 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +2 Query: 293 TGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 TG+ RGF F+ F + K + H I K VD +KA +H Sbjct: 43 TGKPRGFGFVRFANDCDVVKAL-RDTHFILGKPVDVRKAIRKH 84 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 44.4 bits (100), Expect = 9e-05 Identities = 28/109 (25%), Positives = 54/109 (49%), Gaps = 8/109 (7%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVD 397 F ++ +N+ D T SRG F++ + E DK++ A G +++ K Sbjct: 38 FQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYA 97 Query: 398 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKE 544 + + K+FVG L +S+ E+++ FS++GTI + + Q+T + Sbjct: 98 DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSK 146 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 44.4 bits (100), Expect = 9e-05 Identities = 28/109 (25%), Positives = 54/109 (49%), Gaps = 8/109 (7%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVD 397 F ++ +N+ D T SRG F++ + E DK++ A G +++ K Sbjct: 38 FQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYA 97 Query: 398 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKE 544 + + K+FVG L +S+ E+++ FS++GTI + + Q+T + Sbjct: 98 DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSK 146 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = +2 Query: 419 HGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 H K+FVGGL+ E DE+R +F +FG ILE Sbjct: 16 HTKVFVGGLAWETPTDEMRRYFDQFGEILE 45 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 K+FVGGL+WET E+R +F + Sbjct: 18 KVFVGGLAWETPTDEMRRYFDQF 40 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 EI + TD TG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 42 EILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKAN 88 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 41.1 bits (92), Expect = 8e-04 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 12/93 (12%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----DPKKAKARHG 424 + +N+ + T RG F+ E DKV+ ++ +NKK P + K G Sbjct: 38 VNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQVKYADG 93 Query: 425 -------KIFVGGLSSEISDDEIRNFFSEFGTI 502 K+FVG L +S+ E+++ FSE+GTI Sbjct: 94 ELERLEHKLFVGMLPKNVSETEVQSLFSEYGTI 126 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 59 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 108 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/46 (36%), Positives = 29/46 (63%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 66 YDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 111 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +2 Query: 350 KVMAAGEHTINNKK---VDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 K + +H + NK + + KIFVGGL+S +++ E + +F++FG I + Sbjct: 6 KAVPRDDHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITD 61 Score = 31.5 bits (68), Expect = 0.67 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 162 APGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 +PG + +K+FVGGL+ T+ E + +F + Sbjct: 26 SPGPSNSKKIFVGGLASSVTEAEFKKYFAQF 56 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 33.5 bits (73), Expect = 0.17 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKP 660 +D+ + KGF F+T++S Q V + +K+ + G+++ V A +P Sbjct: 237 YDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEARP 284 Score = 32.7 bits (71), Expect(2) = 0.001 Identities = 20/61 (32%), Positives = 30/61 (49%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F S +E + V D TGRSRGF F+ S+ +V AA + N ++D + + Sbjct: 111 FESAGNVEMVEVIYDKITGRSRGFGFVTM---SSVSEVEAAAQQ-FNGYELDGRPLRVNA 166 Query: 422 G 424 G Sbjct: 167 G 167 Score = 27.1 bits (57), Expect(2) = 0.001 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWR 514 +++VG LS + D + + FSE G ++E R Sbjct: 205 RVYVGNLSWGVDDMALESLFSEQGKVVEAR 234 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 40.3 bits (90), Expect = 0.001 Identities = 30/96 (31%), Positives = 42/96 (43%), Gaps = 8/96 (8%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT--------INNKKVD 397 F + + S+ V D N RS G+A+I F P + M A +T I D Sbjct: 69 FKHVANVVSVRVCRDQNR-RSLGYAYINFSNPNDAYRAMEALNYTPLFDRPIRIMLSNRD 127 Query: 398 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 505 P + G IF+ L + I + + FS FGTIL Sbjct: 128 PSTRLSGKGNIFIKNLDASIDNKALFETFSSFGTIL 163 Score = 38.7 bits (86), Expect = 0.004 Identities = 34/102 (33%), Positives = 48/102 (47%), Gaps = 14/102 (13%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPES----IDKV--MAAGE------HTIN 382 +F S I S V D TGRS+G+ F+ F+ ES IDK+ M + H I Sbjct: 155 TFSSFGTILSCKVAMDV-TGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFVGHFIR 213 Query: 383 NKKV--DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 ++ D R ++V L EI +DE+R F +FG I Sbjct: 214 RQERARDENTPTPRFTNVYVKNLPKEIGEDELRKTFGKFGVI 255 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 39.9 bits (89), Expect = 0.002 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 12/98 (12%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV------- 394 +F + I S V DP+ G+S+G+ F+ + E+ + +N+K+V Sbjct: 152 TFSAFGPILSCKVAVDPS-GQSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYVGPFVH 210 Query: 395 ----DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 496 DP K + ++V LS +SD+E+ F EFG Sbjct: 211 KLQRDPSGEKVKFTNVYVKNLSESLSDEELNKVFGEFG 248 Score = 37.9 bits (84), Expect = 0.008 Identities = 24/97 (24%), Positives = 41/97 (42%), Gaps = 8/97 (8%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV------- 394 +F ++ S+ V D T RS G+ ++ + P+ + + +N + + Sbjct: 64 AFTQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNELNFMALNGRAIRVMYSVR 123 Query: 395 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 505 DP K+ G IF+ L I + FS FG IL Sbjct: 124 DPSLRKSGVGNIFIKNLDKSIDHKALHETFSAFGPIL 160 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 410 KARHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 K++ ++V L ++DD++R F+ FGTI Sbjct: 323 KSQGSNLYVKNLDESVTDDKLREHFAPFGTI 353 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQ 532 IFVGGL + ++DDE+++ F +FG +L + P K+ Sbjct: 262 IFVGGLDANVTDDELKSIFGQFGELLHVKIPPGKR 296 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +3 Query: 141 QDHNSAEAPGRD-DDRKLFVGGLSWETTDKELRDHFGAY 254 Q+ A A D ++ +FVGGL TD EL+ FG + Sbjct: 245 QNTQGANAGDNDPNNTTIFVGGLDANVTDDELKSIFGQF 283 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/34 (47%), Positives = 25/34 (73%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 IFVGGL S ++D++++ FSEFG I+ + P+ K Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGK 341 Score = 31.1 bits (67), Expect = 0.89 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 14/93 (15%) Frame = +2 Query: 254 REIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-----AAGEHTINNKKVD------P 400 REI S+ V + + G S G+ F+ F++ + DKV+ A +T +++ Sbjct: 129 REIVSLKVIRNKHNGSSEGYGFVEFESHDVADKVLQEFNGAPMPNTDQPFRLNWASFSTG 188 Query: 401 KKAKARHG---KIFVGGLSSEISDDEIRNFFSE 490 +K +G IFVG L+ ++SD + FSE Sbjct: 189 EKRLENNGPDLSIFVGDLAPDVSDALLHETFSE 221 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +++ V D NTGRS+G+ F+ F K M Sbjct: 226 VKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 258 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/35 (40%), Positives = 25/35 (71%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQ 532 +FVGGL + ++DD ++N FS++G I+ + P K+ Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKR 297 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/35 (40%), Positives = 25/35 (71%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQ 532 +FVGGL + ++DD ++N FS++G I+ + P K+ Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKR 297 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = +2 Query: 413 ARHG-KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 A+ G +IFVGGLS E++D ++ FS FG IL+ + L + + R Sbjct: 3 AKEGSRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSR 48 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 6/61 (9%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA------GEHTINNKKVDP 400 +F +I + + +TGRSRGF FI F ++D+ + G+ I+ + +P Sbjct: 26 AFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEP 85 Query: 401 K 403 K Sbjct: 86 K 86 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +1 Query: 502 LRMEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPK 657 L ++ ++ + +GF FITF + +++ ++ R G + + V RA PK Sbjct: 34 LDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEPK 86 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/63 (31%), Positives = 33/63 (52%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 418 +F S EIE +V D +TGR +G+ F++FK + + + E + N+ V A + Sbjct: 427 AFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIVVCNLASEK 486 Query: 419 HGK 427 GK Sbjct: 487 PGK 489 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 159 EAPGRD-DDRKLFVGGLSWETTDKELRDHFGAY 254 E+ RD R +FV G W+TT + L+ F +Y Sbjct: 399 ESADRDIAQRNIFVRGFGWDTTQENLKTAFESY 431 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E DE+R +F +FG ILE Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEILE 45 Score = 36.3 bits (80), Expect = 0.024 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 F EI + TD NTG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 37 FEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKAN 88 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET E+R +F Sbjct: 18 KVFVGGLAWETPTDEMRRYF 37 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E DE+R +F +FG ILE Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEILE 45 Score = 36.3 bits (80), Expect = 0.024 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 F EI + TD NTG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 37 FEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKAN 88 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET E+R +F Sbjct: 18 KVFVGGLAWETPTDEMRRYF 37 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 32.7 bits (71), Expect = 0.29 Identities = 21/96 (21%), Positives = 41/96 (42%), Gaps = 8/96 (8%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV--------D 397 F + ++ S+ V D T S G+ ++ + + +K M ++ N K+ D Sbjct: 66 FTEVCQVVSVRVCRDAATNTSLGYGYVNYSNTDDAEKAMQKLNYSYLNGKMIRITYSSRD 125 Query: 398 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 505 ++ G +FV L + + + FS GTI+ Sbjct: 126 SSARRSGVGNLFVKNLDKSVDNKTLHEAFSGCGTIV 161 Score = 29.5 bits (63), Expect(2) = 0.006 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTI 502 ++V L ++D+++R F+EFGTI Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGTI 354 Score = 27.9 bits (59), Expect(2) = 0.006 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK 406 +F I S V D + G+SR F F+ F+ PE + + A +N KK D K+ Sbjct: 244 TFGQYGSISSAVVMRDGD-GKSRCFGFVNFENPEDAARAVEA----LNGKKFDDKE 294 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 38.3 bits (85), Expect = 0.006 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 8/96 (8%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKV-------D 397 F + + ++ V D T RS G+A++ F PE + M + + I ++ + D Sbjct: 65 FNQVAPVHNLRVCRDL-THRSLGYAYVNFANPEDASRAMESLNYAPIRDRPIRIMLSNRD 123 Query: 398 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 505 P + G +F+ L + I + + FS FGTIL Sbjct: 124 PSTRLSGKGNVFIKNLDASIDNKALYETFSSFGTIL 159 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/34 (44%), Positives = 25/34 (73%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 IFVGGL S ++D++++ F+EFG I+ + P+ K Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGK 339 Score = 37.9 bits (84), Expect = 0.008 Identities = 29/93 (31%), Positives = 43/93 (46%), Gaps = 14/93 (15%) Frame = +2 Query: 254 REIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP----------- 400 REI S+ V + N G S G+ F+ F++ + DKV+ T P Sbjct: 127 REIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTG 186 Query: 401 KKAKARHG---KIFVGGLSSEISDDEIRNFFSE 490 +K +G IFVG LS ++SD+ + FSE Sbjct: 187 EKRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +++ V D NTGRS+G+ F+ F K M Sbjct: 224 VKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/36 (52%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRD---HFGAYVK*RVLM*RQ 284 KLF+GGLSW T D LRD HFG V +V++ R+ Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRE 71 Score = 31.1 bits (67), Expect = 0.89 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 K+F+GGLS D +R+ F+ FG +++ + + ++ + R Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSR 76 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/36 (52%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRD---HFGAYVK*RVLM*RQ 284 KLF+GGLSW T D LRD HFG V +V++ R+ Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRE 71 Score = 31.1 bits (67), Expect = 0.89 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 K+F+GGLS D +R+ F+ FG +++ + + ++ + R Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSR 76 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 37.9 bits (84), Expect = 0.008 Identities = 29/93 (31%), Positives = 43/93 (46%), Gaps = 14/93 (15%) Frame = +2 Query: 254 REIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP----------- 400 REI S+ V + N G S G+ F+ F++ + DKV+ T P Sbjct: 127 REIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTG 186 Query: 401 KKAKARHG---KIFVGGLSSEISDDEIRNFFSE 490 +K +G IFVG LS ++SD+ + FSE Sbjct: 187 EKRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +++ V D NTGRS+G+ F+ F K M Sbjct: 224 VKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 37.5 bits (83), Expect = 0.010 Identities = 20/86 (23%), Positives = 37/86 (43%) Frame = +2 Query: 251 IREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKI 430 I EI + + D ++G S+G+AF+ FK + K + K ++ Sbjct: 139 IGEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSLSETKNRL 198 Query: 431 FVGGLSSEISDDEIRNFFSEFGTILE 508 F+G + ++DE R + G +E Sbjct: 199 FIGNIPKNWTEDEFRKVIEDVGPGVE 224 Score = 31.5 bits (68), Expect = 0.67 Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +2 Query: 419 HG-KIFVGGLSSEISDDEIRNFFSEFGTILEWR 514 HG ++F+GGL ++ ++++R+ E G I E R Sbjct: 114 HGSEVFIGGLPRDVGEEDLRDLCEEIGEIFEVR 146 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +2 Query: 260 IESINVKTDP-NTGRSRGFAFIVF 328 +E+I + DP NT R+RGFAF+++ Sbjct: 223 VENIELIKDPTNTTRNRGFAFVLY 246 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 37.1 bits (82), Expect = 0.014 Identities = 21/80 (26%), Positives = 44/80 (55%), Gaps = 10/80 (12%) Frame = +2 Query: 296 GRSRGFAFIVFK-------APESIDKVMAAGEHTINNK---KVDPKKAKARHGKIFVGGL 445 G+SRG+ F+ F+ A ++++ + A + K K D K + ++ +++ L Sbjct: 149 GKSRGYGFVQFEQEDAAHAAIQTLNSTIVADKEIYVGKFMKKTDRVKPEEKYTNLYMKNL 208 Query: 446 SSEISDDEIRNFFSEFGTIL 505 +++S+D +R F+EFG I+ Sbjct: 209 DADVSEDLLREKFAEFGKIV 228 Score = 29.1 bits (62), Expect = 3.6 Identities = 18/97 (18%), Positives = 45/97 (46%), Gaps = 8/97 (8%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-------- 394 +F + + S+ + D ++GRS + + F + + + + +++ N K+ Sbjct: 43 AFAEFKSLTSVRLCKDASSGRSLCYGYANFLSRQDANLAIEKKNNSLLNGKMIRVMWSVR 102 Query: 395 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 505 P + G +FV L +++ +++ F +FG I+ Sbjct: 103 APDARRNGVGNVFVKNLPESVTNAVLQDMFKKFGNIV 139 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = +2 Query: 386 KKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 +K + +K A+ I+V ++ ++++E+R FS+ GTI Sbjct: 292 EKHEEQKMIAKVSNIYVKNVNVAVTEEELRKHFSQCGTI 330 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/56 (30%), Positives = 33/56 (58%) Frame = +2 Query: 362 AGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 AG H N D ++ + IFVGGL ++++++++ FS+FG ++ + P+ K Sbjct: 310 AGGHGGNGSMSD---GESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGK 362 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 36.7 bits (81), Expect = 0.018 Identities = 31/116 (26%), Positives = 49/116 (42%), Gaps = 19/116 (16%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-------- 394 +F EIE D +G+S+G+ FI+FK+ + + I + Sbjct: 147 AFKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARNALKQPQKKIGTRMTACQLASIG 206 Query: 395 ----DPKKAKARH-------GKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 +P A A+H KI+V +S++I ++ FFS FG I E L K Sbjct: 207 PVQGNPVVAPAQHFNPENVQRKIYVSNVSADIDPQKLLEFFSRFGEIEEGPLGLDK 262 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 EIE + D TGR +GFA V+++ ES K + T + KA Sbjct: 252 EIEEGPLGLDKATGRPKGFALFVYRSLESAKKALEEPHKTFEGHVLHCHKA 302 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAY 254 RK+FV GL W+T L D F Y Sbjct: 128 RKIFVHGLGWDTKADSLIDAFKQY 151 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 36.3 bits (80), Expect = 0.024 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 K+FVGGL+WET + LR HF Y Sbjct: 25 KVFVGGLAWETQSETLRQHFEQY 47 Score = 35.1 bits (77), Expect = 0.055 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 EI V D NTGRS+G+ F+ F+ PE+ + A I+ ++ + Sbjct: 49 EILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRAN 95 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E + +R F ++G ILE Sbjct: 25 KVFVGGLAWETQSETLRQHFEQYGEILE 52 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 35.9 bits (79), Expect = 0.031 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 418 +F E+ + D TGRSRGFAF+ F + E M ++ +++ A R Sbjct: 53 AFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATER 112 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 KIFVGG+S + +R FS++G +++ + + ++ + R Sbjct: 35 KIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSR 75 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/45 (24%), Positives = 25/45 (55%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 D+ + +GF F+TF S + ++ ++ + + G+ + V AT + Sbjct: 68 DRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATER 112 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 K+FVGG+S+ T + LR+ F Y Sbjct: 35 KIFVGGISYSTDEFGLREAFSKY 57 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 35.9 bits (79), Expect = 0.031 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 K+FVGGL+WET + LR HF Y Sbjct: 25 KVFVGGLAWETQSETLRRHFDQY 47 Score = 34.7 bits (76), Expect = 0.072 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +2 Query: 275 VKTDPNTGRSRGFAFIVFKAPES 343 V TD NTGRS+G+ F+ F+ PE+ Sbjct: 55 VITDKNTGRSKGYGFVTFRDPEA 77 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E + +R F ++G ILE Sbjct: 25 KVFVGGLAWETQSETLRRHFDQYGDILE 52 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 35.5 bits (78), Expect = 0.041 Identities = 19/51 (37%), Positives = 26/51 (50%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 EI V D T RS+GF F+ F+ ES + HTI+ + V+ K A Sbjct: 34 EIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 648 D + KGF F+TF + + P TI G+ V+ K A Sbjct: 43 DGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 35.5 bits (78), Expect = 0.041 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVGGL+ E D +R +F +FG I+E Sbjct: 23 KIFVGGLAWETQRDTMRRYFEQFGEIVE 50 Score = 34.7 bits (76), Expect = 0.072 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPES 343 F EI V TD NTGRS+G+ F+ FK E+ Sbjct: 42 FEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEA 75 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET +R +F Sbjct: 23 KIFVGGLAWETQRDTMRRYF 42 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 35.1 bits (77), Expect = 0.055 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDHFGAY 254 D + + F+GGL+W T+D+ LRD F Y Sbjct: 4 DPEYRCFIGGLAWTTSDRGLRDAFEKY 30 Score = 32.3 bits (70), Expect = 0.39 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +2 Query: 275 VKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVDPKKAKARHG 424 V D +GRSRGF FI F +++D+ +AA ++ + + KA+ G Sbjct: 38 VVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQPHQG 88 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATP 654 DK + +GF FITF+ ++ +++ + + G+ + V +A P Sbjct: 41 DKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQP 85 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 34.7 bits (76), Expect = 0.072 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E +RN+F +FG I+E Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFGDIVE 35 Score = 31.9 bits (69), Expect = 0.51 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 +E++ V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 34 VEAV-VITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 Score = 31.1 bits (67), Expect = 0.89 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET LR++F Sbjct: 8 KVFVGGLAWETHKVSLRNYF 27 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 34.7 bits (76), Expect = 0.072 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E +RN+F +FG I+E Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFGDIVE 35 Score = 31.9 bits (69), Expect = 0.51 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 +E++ V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 34 VEAV-VITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 Score = 31.1 bits (67), Expect = 0.89 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET LR++F Sbjct: 8 KVFVGGLAWETHKVSLRNYF 27 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 34.3 bits (75), Expect = 0.096 Identities = 11/41 (26%), Positives = 27/41 (65%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 K+F+GG++ + +D +R F+++G +++ R L ++ + R Sbjct: 41 KLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSR 81 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 364 +F E+ V D TGRSRGF F+ F + E+ + A Sbjct: 59 AFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQA 100 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 34.3 bits (75), Expect = 0.096 Identities = 17/70 (24%), Positives = 33/70 (47%) Frame = +2 Query: 338 ESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILEWRC 517 E +++ GE + +K +A G+++VG L I+ E+ F E GT+++ + Sbjct: 89 EEVEEEGDEGEEEVEEEK-QTTQASGEEGRLYVGNLPYTITSSELSQIFGEAGTVVDVQI 147 Query: 518 PLTKQRTKER 547 K + R Sbjct: 148 VYDKVTDRSR 157 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +2 Query: 290 NTGRSRGFAFIVFKAPESIDKVMA 361 NTGRSRGF FI F++ E++ +A Sbjct: 255 NTGRSRGFGFISFESAENVQSALA 278 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDHFG 248 D K++ G L W T + L+D FG Sbjct: 216 DSPHKVYAGNLGWNLTSQGLKDAFG 240 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +F S E+ V D TGRSRGF F+ F +S + + Sbjct: 54 AFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 33.5 bits (73), Expect = 0.17 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 99 NQLNGNAENGGGDSQDHNSAEAPG--RDDDRKLFVGGLSWETTDKELRDHFGAY 254 N+L+G G S + G R KLFVGGLSW T D L+ F ++ Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLKQAFTSF 58 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGLS D ++ F+ FG + E Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGEVTE 63 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +F S E+ V D TGRSRGF F+ F +S + + Sbjct: 54 AFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 33.5 bits (73), Expect = 0.17 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 99 NQLNGNAENGGGDSQDHNSAEAPG--RDDDRKLFVGGLSWETTDKELRDHFGAY 254 N+L+G G S + G R KLFVGGLSW T D L+ F ++ Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLKQAFTSF 58 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGLS D ++ F+ FG + E Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGEVTE 63 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 33.9 bits (74), Expect = 0.13 Identities = 19/50 (38%), Positives = 33/50 (66%), Gaps = 3/50 (6%) Frame = +3 Query: 135 DSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELR---DHFGAYVK*RVLM 275 DS+D + +E+P +KLF+ GLS+ T++K LR + FG V+ +++M Sbjct: 267 DSRDQDDSESPPVKT-KKLFITGLSFYTSEKTLRAAFEGFGELVEVKIIM 315 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/64 (25%), Positives = 30/64 (46%) Frame = +2 Query: 338 ESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILEWRC 517 ES++K + + D + + K+F+ GLS S+ +R F FG ++E + Sbjct: 254 ESLNKDYEGDSTQDSRDQDDSESPPVKTKKLFITGLSFYTSEKTLRAAFEGFGELVEVKI 313 Query: 518 PLTK 529 + K Sbjct: 314 IMDK 317 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 K+F+GGLS + + +++ FS FG + E R K + R Sbjct: 42 KLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSR 82 Score = 32.7 bits (71), Expect = 0.29 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GGLSW ++ L+D F ++ Sbjct: 42 KLFIGGLSWSVDEQSLKDAFSSF 64 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVF 328 +F S E+ + + D +GRSRGF F+ F Sbjct: 60 AFSSFGEVAEVRIAYDKGSGRSRGFGFVDF 89 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 33.9 bits (74), Expect = 0.13 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 180 DRKLFVGGLSWETTDKELRDHFGAYVK 260 + ++FVGGLSW+ T+++L F Y K Sbjct: 11 ESRIFVGGLSWDVTERQLESTFDRYGK 37 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 544 KGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPK 657 +GF FITF + +D +K R +G K + V +A PK Sbjct: 53 RGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPK 91 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 +IFVGGLS ++++ ++ + F +G I E Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKITE 40 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKARHG 424 +I + +TGR RGF FI F D + + NK + KA+ + G Sbjct: 37 KITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVG 93 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 33.9 bits (74), Expect = 0.13 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 180 DRKLFVGGLSWETTDKELRDHFGAYVK 260 + ++FVGGLSW+ T+++L F Y K Sbjct: 11 ESRIFVGGLSWDVTERQLESTFDRYGK 37 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 544 KGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPK 657 +GF FITF + +D +K R +G K + V +A PK Sbjct: 53 RGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPK 91 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 +IFVGGLS ++++ ++ + F +G I E Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKITE 40 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKARHG 424 +I + +TGR RGF FI F D + + NK + KA+ + G Sbjct: 37 KITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVG 93 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 33.9 bits (74), Expect = 0.13 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 21/102 (20%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----DPKKAKARHG 424 + +N+ + T RG F+ E DKV+ ++ +NKK P + K G Sbjct: 38 VNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQVKYADG 93 Query: 425 ----------------KIFVGGLSSEISDDEIRNFFSEFGTI 502 K+FVG L +S+ E+++ FSE+GTI Sbjct: 94 ELERLDVLDCSCNPEHKLFVGMLPKNVSETEVQSLFSEYGTI 135 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 + V TDP+TGRS+G+ F+ F ++ MA Sbjct: 143 VRGAKVVTDPSTGRSKGYGFVKFAEESERNRAMA 176 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +2 Query: 395 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 +P++ + GKIFVG L + I E FF +FG I Sbjct: 156 NPQQEFRQEGKIFVGNLPTWIKKPEFEEFFRQFGPI 191 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 660 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 F EIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 660 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 F EIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 660 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 F EIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 33.5 bits (73), Expect = 0.17 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPL 523 K++VGG+ + ++DEIR++F G I++ C + Sbjct: 162 KLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKM 194 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/20 (45%), Positives = 17/20 (85%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 KL+VGG+ +++T+ E+R +F Sbjct: 162 KLYVGGIPYQSTEDEIRSYF 181 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDHF 245 D ++++G L+W+TT++++R F Sbjct: 259 DGYNRVYIGNLAWDTTERDIRKLF 282 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/58 (25%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI-NNKKVDPKKAKARHGK 427 ++ +++ DP T SRGF FI K+ ++ + + +H++ + + +KA+ R G+ Sbjct: 100 KVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKARRRRGR 157 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 150 NSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 245 + AE PG L+V GLS T+++L DHF Sbjct: 68 SDAENPGNS----LYVTGLSHRVTERDLEDHF 95 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 F + ++E + D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 187 FMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/81 (25%), Positives = 38/81 (46%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F S ++E V D TG+S+G+ F+ F +D + A + +KK+D + + Sbjct: 95 FSSYGDLEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQL 149 Query: 422 GKIFVGGLSSEISDDEIRNFF 484 G S+I+D +R + Sbjct: 150 AASGNQGTGSQIADISMRKIY 170 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 648 FDK + +GF +++ + L P + I GK ++ K A Sbjct: 200 FDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAY 254 RKLF+ GL+ +TT + LR F +Y Sbjct: 75 RKLFIRGLAADTTTEGLRSLFSSY 98 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 409 F + ++E + D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 187 FMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/81 (25%), Positives = 38/81 (46%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F S ++E V D TG+S+G+ F+ F +D + A + +KK+D + + Sbjct: 95 FSSYGDLEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQL 149 Query: 422 GKIFVGGLSSEISDDEIRNFF 484 G S+I+D +R + Sbjct: 150 AASGNQGTGSQIADISMRKIY 170 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 648 FDK + +GF +++ + L P + I GK ++ K A Sbjct: 200 FDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAY 254 RKLF+ GL+ +TT + LR F +Y Sbjct: 75 RKLFIRGLAADTTTEGLRSLFSSY 98 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/85 (21%), Positives = 37/85 (43%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F + E+ + + +P T +S+G AF+ F E + + + + N K A + Sbjct: 234 FGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKELKSPMINGKKCGVTASQDN 293 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFG 496 +FVG + + + +R +G Sbjct: 294 DTLFVGNICKIWTPEALREKLKHYG 318 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 394 EI +V D +TGR++GF F++FK + + E + N+ V Sbjct: 188 EITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTV 233 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 159 EAPGRDDD-RKLFVGGLSWETTDKELRDHFGAY 254 E+ RD R +FV GL W+TT + L+ F Y Sbjct: 154 ESADRDSSQRNIFVRGLGWDTTHENLKAAFEVY 186 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATP 654 DK + KGF F+ F++ + LK P++ + + V A P Sbjct: 197 DKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTVSCLPARP 240 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 32.7 bits (71), Expect = 0.29 Identities = 16/62 (25%), Positives = 28/62 (45%) Frame = +2 Query: 329 KAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 K ++ V A + K + + +F G LS +I+ +I NFF E G +++ Sbjct: 353 KKDSDVEMVDAEQKSNAKQPKTPTNQTQGGSKTLFAGNLSYQIARSDIENFFKEAGEVVD 412 Query: 509 WR 514 R Sbjct: 413 VR 414 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFI 322 E+ ++V TD TG SRGFA+I Sbjct: 508 EVTRVHVPTDRETGASRGFAYI 529 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 32.3 bits (70), Expect = 0.39 Identities = 23/110 (20%), Positives = 46/110 (41%), Gaps = 14/110 (12%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVDPKKAKARHGK--- 427 +E V + +T +SRGF F+ E +K + +N +++ +A R + Sbjct: 139 VEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPRGSRPER 198 Query: 428 ----------IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 I+VG L ++ + FSE G +++ R ++ + R Sbjct: 199 QPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSR 248 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 364 ++ V +D TGRSRGF F+ ++ +AA Sbjct: 232 KVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAA 267 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 K+FVGGL+W+T + + DHF Y Sbjct: 18 KVFVGGLAWDTHKEAMYDHFIKY 40 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 +F S ++ V TD ++GRS+GF F+ + E +K A Sbjct: 53 AFASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKA 93 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 388 EIE V D TG+++GF F++FK + + + + I N+ Sbjct: 129 EIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 660 DK + KGF F+ F++ + + LK PK+ I + + A+ P Sbjct: 138 DKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGP 183 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 159 EAPGRD-DDRKLFVGGLSWETTDKELRDHFGAY 254 EA RD RK+FV GL WETT + L F Y Sbjct: 95 EAADRDVTHRKIFVYGLPWETTRETLVGVFEGY 127 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 388 EIE V D TG+++GF F++FK + + + + I N+ Sbjct: 129 EIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 660 DK + KGF F+ F++ + + LK PK+ I + + A+ P Sbjct: 138 DKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGP 183 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 159 EAPGRD-DDRKLFVGGLSWETTDKELRDHFGAY 254 EA RD RK+FV GL WETT + L F Y Sbjct: 95 EAADRDVTHRKIFVYGLPWETTRETLVGVFEGY 127 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/61 (24%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKA 415 +F ++ + D TGRSRGF F+ FK +++ D + ++ + + +A++ Sbjct: 27 AFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQS 86 Query: 416 R 418 R Sbjct: 87 R 87 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDHFGAY 254 D + + FVGGL+W T D+ L F Y Sbjct: 5 DVEYRCFVGGLAWATDDRALETAFAQY 31 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/61 (24%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKA 415 +F ++ + D TGRSRGF F+ FK +++ D + ++ + + +A++ Sbjct: 27 AFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQS 86 Query: 416 R 418 R Sbjct: 87 R 87 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDHFGAY 254 D + + FVGGL+W T D+ L F Y Sbjct: 5 DVEYRCFVGGLAWATDDRALETAFAQY 31 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 31.9 bits (69), Expect = 0.51 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQ 532 IFVG + +++D++++ F +FG ++ + P K+ Sbjct: 280 IFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAGKR 314 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 31.9 bits (69), Expect = 0.51 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 ++++ V TDP T +G AF+ F ES+ K +A Sbjct: 471 VQNVIVVTDPVTRHPKGTAFVTFATKESVGKAVA 504 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 31.9 bits (69), Expect = 0.51 Identities = 16/74 (21%), Positives = 33/74 (44%) Frame = +2 Query: 308 GFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFS 487 G I + I V+ + + ++ P + K++V GLS ++D +R+ F Sbjct: 39 GTGVISARRRRDIGGVLISSCLSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFE 98 Query: 488 EFGTILEWRCPLTK 529 +FG ++ + K Sbjct: 99 QFGNLIHMNMVMDK 112 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 KL+V GLS+ TT+ LRD F Sbjct: 78 KLYVSGLSFRTTEDTLRDTF 97 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 31.9 bits (69), Expect = 0.51 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E + ++ F +FG ILE Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILE 41 Score = 31.5 bits (68), Expect = 0.67 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET + ++ HF Sbjct: 14 KVFVGGLAWETHKETMKKHF 33 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 F EI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 31.9 bits (69), Expect = 0.51 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E + ++ F +FG ILE Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILE 41 Score = 31.5 bits (68), Expect = 0.67 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET + ++ HF Sbjct: 14 KVFVGGLAWETHKETMKKHF 33 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 F EI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 31.9 bits (69), Expect = 0.51 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E + ++ F +FG ILE Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILE 41 Score = 31.5 bits (68), Expect = 0.67 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET + ++ HF Sbjct: 14 KVFVGGLAWETHKETMKKHF 33 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 F EI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 31.9 bits (69), Expect = 0.51 Identities = 33/108 (30%), Positives = 47/108 (43%), Gaps = 25/108 (23%) Frame = +2 Query: 266 SINVKTDPNTGRSRGFAFIVFK-------APESIDKVMAAGEH------------TINNK 388 S+ V +P TG SRG ++ A S+D G T N Sbjct: 136 SVEVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVRYSVDMNPGTRRNP 195 Query: 389 KV---DPKKA---KARHGKIFVGGLSSEISDDEIRNFFSEFGTILEWR 514 +V PKK +++H K++VG L D +RN FS+FGTI+ R Sbjct: 196 EVLNSTPKKILMYESQH-KVYVGNLPWFTQPDGLRNHFSKFGTIVSTR 242 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDH---FGAYVK*RVL 272 + K++VG L W T LR+H FG V RVL Sbjct: 209 ESQHKVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVL 244 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 31.5 bits (68), Expect = 0.67 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVDPKKA 409 ++ S V P T +S GF F+ F + E ++ ++A + +K+ KA Sbjct: 202 KVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA 253 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 31.5 bits (68), Expect = 0.67 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVG L+ + D++R +F +FG +++ Sbjct: 13 KIFVGNLTWRTTADDLRRYFEQFGQVVD 40 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVG L+W TT +LR +F Sbjct: 13 KIFVGNLTWRTTADDLRRYF 32 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 31.1 bits (67), Expect = 0.89 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 364 +F S + V T+ TGRSRG+ F+ F + +S + ++A Sbjct: 50 AFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISA 91 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 K+++GGLS + +++ FS F + E R K + R Sbjct: 32 KLYIGGLSPGTDEHSLKDAFSSFNGVTEARVMTNKVTGRSR 72 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 31.1 bits (67), Expect = 0.89 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAK 412 IE++ V DP+ +G A+++FK E+ + V+ G + +++ + K Sbjct: 313 IEAVRVIRDPHLNIGKGIAYVLFKTREAANLVLKKGYLKLRERELRISRVK 363 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 31.1 bits (67), Expect = 0.89 Identities = 22/110 (20%), Positives = 46/110 (41%), Gaps = 14/110 (12%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVDPKKAKARHGK--- 427 +E V + T +SRGF F+ + + + + + +N + + KA R + Sbjct: 176 VEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPRGSRPER 235 Query: 428 ----------IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 ++VG L ++ + + FSE G ++E R ++ + R Sbjct: 236 APRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSR 285 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 364 ++ V D TGRSRGF F+ + +++ ++A Sbjct: 269 KVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISA 304 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 31.1 bits (67), Expect = 0.89 Identities = 26/93 (27%), Positives = 40/93 (43%), Gaps = 12/93 (12%) Frame = +2 Query: 263 ESINVKTDPNTGRSRGFAFIVFKAPE-------SIDKVMAAGEHTINNKKVDPKKAK--- 412 E + V + +TG+SRGFAF+ E ++D G N PK K Sbjct: 112 ELVEVLYNRDTGQSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFADKPKPNKEPL 171 Query: 413 --ARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 505 K+FVG LS ++ + + F E G ++ Sbjct: 172 YPETEHKLFVGNLSWTVTSESLAGAFRECGDVV 204 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +3 Query: 108 NGNAENGGGDSQDHNSAEAPGRD--DDRKLFVGGLSWETTDKELRDHFGAYVK 260 +G+A GD + ++A D D +LFV L + T++EL +HF + K Sbjct: 234 DGDAMEVEGDGKVAQESKAVSDDVLDTGRLFVRNLPYTATEEELMEHFSTFGK 286 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPES 343 EI +N+ D TG+S+GFAF+ ++ S Sbjct: 61 EIVDVNLIRDKGTGKSKGFAFLAYEDQRS 89 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 248 SIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 364 S + N+ D TG S+G+AF V++ P D AA Sbjct: 397 SFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAA 435 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 30.3 bits (65), Expect = 1.6 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 8/66 (12%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVDPKKAK 412 ++ + + D TG SRGFAF+ + KA E +D +V+ E T+ K P K Sbjct: 41 KVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYGPNAEK 100 Query: 413 ARHGKI 430 G++ Sbjct: 101 ISKGRV 106 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 30.3 bits (65), Expect = 1.6 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 8/66 (12%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVDPKKAK 412 ++ + + D TG SRGFAF+ + KA E +D +V+ E T+ K P K Sbjct: 41 KVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYGPNAEK 100 Query: 413 ARHGKI 430 G++ Sbjct: 101 ISKGRV 106 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +3 Query: 102 QLNGNAENGGGDSQDHN---SAEAPGRDDDRKLFVGGLSWETTDKELRDHF 245 ++ AE G SQD + SA D R ++VG + + T +E++ HF Sbjct: 73 EMQAKAEKDMGASQDPSGGVSAAEKEEVDSRSIYVGNVDYACTPEEVQQHF 123 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 + FVGGL+ +D++++ FS+FG +++ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVID 34 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 + FVGGL+W T D++L+ F + Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQF 29 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFK 331 +F ++ + D +GRSRGF F+ FK Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 + FVGGL+ +D++++ FS+FG +++ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVID 34 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 +F ++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 + FVGGL+W T D++L+ F + Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQF 29 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 636 D+ + +GF F+TF+ E+ + D ++ + GKE+D Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIE----EMNGKELD 73 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 + FVGGL+ +D++++ FS+FG +++ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVID 34 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 +F ++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 + FVGGL+W T D++L+ F + Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQF 29 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 636 D+ + +GF F+TF+ E+ + D ++ + GKE+D Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIE----EMNGKELD 73 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 + FVGGL+ +D++++ FS+FG +++ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVID 34 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 +F ++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 + FVGGL+W T D++L+ F + Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQF 29 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 636 D+ + +GF F+TF+ E+ + D ++ + GKE+D Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIE----EMNGKELD 73 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 347 DKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 DK + G + ++ D K + ++V L+ +DD+++N F E+G I Sbjct: 5 DKQVYVGPF-LRRQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFGEYGKI 55 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 410 KARHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 K + ++V L ISD++++ FS FGT+ Sbjct: 128 KFQSSNLYVKNLDPSISDEKLKEIFSPFGTV 158 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 + S V DPN G S+G F+ F PE + M+ Sbjct: 158 VTSSKVMRDPN-GTSKGSGFVAFATPEEATEAMS 190 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVG + +++EIR +F + G +LE Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLE 148 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/84 (21%), Positives = 38/84 (45%), Gaps = 11/84 (13%) Frame = +2 Query: 284 DPNTGRSRGFAFIVFKAPESIDKVMAA---------GEHTINNKKVDPKKAK--ARHGKI 430 D TG+ +G F+ + + D+ + A G + + D ++ + K+ Sbjct: 154 DKRTGQQQGCCFVKYATSKDADRAIRALHNQITLPGGTGPVQVRYADGERERIGTLEFKL 213 Query: 431 FVGGLSSEISDDEIRNFFSEFGTI 502 FVG L+ + ++ E+ F +FG + Sbjct: 214 FVGSLNKQATEKEVEEIFLQFGHV 237 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVG + +++EIR +F + G +LE Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLE 148 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/84 (21%), Positives = 38/84 (45%), Gaps = 11/84 (13%) Frame = +2 Query: 284 DPNTGRSRGFAFIVFKAPESIDKVMAA---------GEHTINNKKVDPKKAK--ARHGKI 430 D TG+ +G F+ + + D+ + A G + + D ++ + K+ Sbjct: 154 DKRTGQQQGCCFVKYATSKDADRAIRALHNQITLPGGTGPVQVRYADGERERIGTLEFKL 213 Query: 431 FVGGLSSEISDDEIRNFFSEFGTI 502 FVG L+ + ++ E+ F +FG + Sbjct: 214 FVGSLNKQATEKEVEEIFLQFGHV 237 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 30.3 bits (65), Expect = 1.6 Identities = 21/90 (23%), Positives = 40/90 (44%), Gaps = 12/90 (13%) Frame = +2 Query: 269 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-------GEHTINNKKVDPKKAKARHGK 427 ++ K G+S+GF F+ F +S +A G+ K ++ + A G Sbjct: 139 LSCKVVEENGQSKGFGFVQFDTEQSAVSARSALHGSMVYGKKLFVAKFINKDERAAMAGN 198 Query: 428 -----IFVGGLSSEISDDEIRNFFSEFGTI 502 ++V L ++DD + FS++GT+ Sbjct: 199 QDSTNVYVKNLIETVTDDCLHTLFSQYGTV 228 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 + S+ V D GRSRGF F+ F PE+ K M Sbjct: 228 VSSVVVMRD-GMGRSRGFGFVNFCNPENAKKAM 259 >At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 483 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +3 Query: 132 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 G + + + E+P R L+VGGL+ ++++RD F A+ Sbjct: 211 GKAGEMGTLESPEDQSIRTLYVGGLNSRVLEQDIRDQFYAH 251 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 30.3 bits (65), Expect = 1.6 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 7/88 (7%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESID---KVMAA----GEHTINNKKVDPKKAKAR 418 + ++ V D T + + FI +++ E D KV+ G+ NK KK+ Sbjct: 51 VVNVYVPKDRVTNLHQNYGFIEYRSEEDADYAIKVLNMIKLHGKPIRVNKASQDKKSLDV 110 Query: 419 HGKIFVGGLSSEISDDEIRNFFSEFGTI 502 +F+G L ++ + + + FS FG I Sbjct: 111 GANLFIGNLDPDVDEKLLYDTFSAFGVI 138 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +2 Query: 275 VKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTINNK 388 + DP+TG SRGF FI + + E+ D + + G++ N + Sbjct: 144 IMRDPDTGNSRGFGFISYDSFEASDAAIESMTGQYLSNRQ 183 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 365 GEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 GE NN + + + + VG +SS + D E++ F +FG I Sbjct: 198 GERGGNNSVGELNRGEIPSRTLLVGNISSNVEDYELKVLFEQFGDI 243 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKE 544 +FV G S +S+ ++ FSEFG + + + +RT++ Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKI-IANERTRQ 97 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKE 544 +FV G S +S+ ++ FSEFG + + + +RT++ Sbjct: 79 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKI-IANERTRQ 116 >At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 363 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 159 EAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 E P + + L+VGGL+ ++++ DHF AY Sbjct: 217 EPPEDESIKTLYVGGLNSRIFEQDIHDHFYAY 248 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 29.9 bits (64), Expect = 2.1 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI---NNKKVDPKKAKARHG 424 I+ + + D T SRGFAF+ F + E K + A T N K + AK+ HG Sbjct: 484 IKDLRLVRDKFTHVSRGFAFVHFYSVEDATKALEATNRTALERNGKILRVAYAKSVHG 541 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 373 + + V + N+G SRGFAFI F ++ +M EH Sbjct: 324 LHHVRVIREQNSGISRGFAFIDFPTVDAARTMMDRIEH 361 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESID 349 F S +E + V D TGRSRGF F+ ++ Sbjct: 119 FESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 660 +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 282 YDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 329 Score = 27.9 bits (59), Expect = 8.3 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 9/63 (14%) Frame = +3 Query: 111 GNAENGGG------DSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF---GAYVK* 263 G+ +GGG S S G +L+VG LSW D L + F G V+ Sbjct: 219 GSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMALENLFNEQGKVVEA 278 Query: 264 RVL 272 RV+ Sbjct: 279 RVI 281 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/46 (23%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +2 Query: 284 DPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 418 D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 283 DRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 328 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESID 349 F S +E + V D TGRSRGF F+ ++ Sbjct: 119 FESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 660 +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 290 YDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 337 Score = 27.9 bits (59), Expect = 8.3 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 9/63 (14%) Frame = +3 Query: 111 GNAENGGG------DSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF---GAYVK* 263 G+ +GGG S S G +L+VG LSW D L + F G V+ Sbjct: 227 GSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMALENLFNEQGKVVEA 286 Query: 264 RVL 272 RV+ Sbjct: 287 RVI 289 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/46 (23%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +2 Query: 284 DPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 418 D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 291 DRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 336 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWR 514 ++VGG+ +S D++ FS+FG I ++R Sbjct: 252 LWVGGIGPNVSKDDLEEEFSKFGKIEDFR 280 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +3 Query: 108 NGNAENGG--GDSQDHNSAEAPGRDDDR 185 +GN E G GD D++ + PG DDD+ Sbjct: 962 DGNHERGSESGDGDDYDDGDGPGSDDDK 989 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFK 331 SF + V D TGRSRGF F+ F+ Sbjct: 167 SFSAFNSCSDARVMWDQKTGRSRGFGFVSFR 197 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 395 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 505 DP + G +FV L I + ++ + FS FG +L Sbjct: 22 DPSNRMSGRGNVFVKNLDESIDNKQLCDMFSAFGKVL 58 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +3 Query: 132 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 G + + + E+P + + L+VGGL+ ++++RD F A+ Sbjct: 211 GKAGEMGTLESPDDESIKTLYVGGLNSRILEQDIRDQFYAH 251 >At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 817 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 427 ++SI + +TG+ RG A+ F E + +A KK+ ++ + GK Sbjct: 677 VDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKKGK 732 >At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 816 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 427 ++SI + +TG+ RG A+ F E + +A KK+ ++ + GK Sbjct: 677 VDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKKGK 732 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 66 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDR 185 NDN + +N N N NGGG ++ S P R+ DR Sbjct: 119 NDNNGNNNNGNNNDNNNQNNGGG--SNNRSPPPPSRNSDR 156 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQDHNS 155 NN N D +N N N +N G+++D+N+ Sbjct: 76 NNGNNNNDNNNNNNGNNNNDNNNGNNKDNNN 106 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESI 346 E+ + D TGRS+GF F+ FK +S+ Sbjct: 69 EVFDSKIIIDRETGRSKGFRFVTFKDEDSM 98 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = +2 Query: 431 FVGGLSSEISDDEIRNFFSEFGTIL 505 +VG L S+ +++++N FS+FG ++ Sbjct: 11 YVGNLESDTEENDLKNAFSQFGDVI 35 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +1 Query: 523 DKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKE--VDVKRAT 651 D T + KGF F FES E ++ + +RTI G+E V+V +AT Sbjct: 237 DPTTKKPKGFGFYEFESAEGILRAIRLLTQRTIDGQELLVNVNQAT 282 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 +++VG LS +DD +R FS +G +++ Sbjct: 4 RVYVGNLSPTTTDDMLREAFSGYGNVVD 31 >At2g47390.1 68415.m05915 expressed protein Length = 961 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 108 NGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRD 239 +G AE+GGG S SA A +DD G + E+RD Sbjct: 78 SGGAEDGGGTSNGSLSASATATEDDELAI--GTGYRLPPPEIRD 119 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +1 Query: 502 LRMEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEV 633 L++++ DK + + KGF ++TF S E+ LL+ + + G+ V Sbjct: 48 LKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLVDGRVV 92 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVF 328 F S EI++++V D +TG S+G A++ F Sbjct: 425 FSSCGEIKNVSVPIDRDTGNSKGIAYLEF 453 >At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 391 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +1 Query: 520 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 660 F +T+ G C F+ FE V + +K +GG++V ++ P P Sbjct: 289 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNP 337 >At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 450 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +1 Query: 520 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 660 F +T+ G C F+ FE V + +K +GG++V ++ P P Sbjct: 348 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNP 396 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVF 328 F + +E + + DP TG+ +GF FI F Sbjct: 285 FEAFGPVELVQLPLDPETGQCKGFGFIQF 313 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 28.7 bits (61), Expect = 4.7 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTI 502 +++VG L +S+D++R F FG++ Sbjct: 286 RLYVGNLHINMSEDDLRKVFESFGSV 311 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/46 (26%), Positives = 26/46 (56%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 394 ++ +++ DP T SRGF FI K+ ++ + + +H++ +V Sbjct: 70 KVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRV 115 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 150 NSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 245 + AE PG L+V GLS T+++L DHF Sbjct: 38 SDAENPGNS----LYVTGLSHRVTERDLEDHF 65 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRA 648 D+ + KGF FITFESE LK + + G+ + V+ A Sbjct: 100 DQQTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETA 142 >At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 130 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTI 502 +FV G S +S+ ++ FSEFG + Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQV 84 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 +++G + + EI FFS+FGT+ R K+ K + Sbjct: 62 LYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSK 101 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFK 331 SF V D TGRSRGF F+ F+ Sbjct: 163 SFSVFSSCSDARVMWDQKTGRSRGFGFVSFR 193 >At2g33440.1 68415.m04099 splicing factor family protein similar to Splicing factor U2AF 65 kDa subunit (U2 snRNP auxiliary factor large subunit) {Homo sapiens} SP|P26368, {Mus musculus} SP|P26369; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 247 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWR 514 KIF+GG S IS + + S FG + +R Sbjct: 41 KIFIGGFSKAISSEMLMEIVSVFGPLKAYR 70 >At1g62170.1 68414.m07013 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 GI:9937311 from [Cucurbita maxima]; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 433 Score = 28.3 bits (60), Expect = 6.3 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +2 Query: 383 NKKVDPKKAKARHGKIFVGGLS-SEISDDEIRNFFSEFGTILEWRCPLTKQRTKERASVS 559 +KK PK A +G LS + +S D +NFFS +++R + RT+ A S Sbjct: 150 SKKGGPKIAVV-NGMWMDQSLSVNPLSKDLFKNFFSAAFAQVDFRSKAEEVRTEVNAWAS 208 Query: 560 SHLN 571 SH N Sbjct: 209 SHTN 212 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 397 +F S +I V D +G SRGF F+ + + E + M A + NK++D Sbjct: 55 AFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQA----MQNKELD 103 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVGGLS + ++ F FG I++ Sbjct: 37 KIFVGGLSPSTDVELLKEAFGSFGKIVD 64 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +3 Query: 93 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDH 242 T NG GGG + + P R + ++ V GL + ++L+DH Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDH 138 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +3 Query: 93 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDH 242 T NG GGG + + P R + ++ V GL + ++L+DH Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDH 138 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +3 Query: 93 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDH 242 T NG GGG + + P R + ++ V GL + ++L+DH Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDH 138 >At5g22830.1 68418.m02669 magnesium transporter CorA-like family protein weak similarity to SP|Q01926 RNA splicing protein MRS2, mitochondrial precursor {Saccharomyces cerevisiae}; contains Pfam profile PF01544: CorA-like Mg2+ transporter protein; supporting cDNA gi|12007446|gb|AF322255.1|AF322255 Length = 459 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 60 ANNDNFAQDITTDNQ-LNGNAENGGGDSQDHNSAEAPGRDDDRKL 191 A + A+D D + LN + ++ G DS + GRDD +K+ Sbjct: 65 AKSPTTAEDFVGDYESLNVSDDDDGSDSNSSDGDNGGGRDDSKKI 109 >At3g21100.1 68416.m02667 RNA recognition motif (RRM)-containing protein contains Pfam profile:PF00076 RNA recognition motif Length = 602 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +2 Query: 449 SEISDDEIRNFFSEFGTILEWRCPLTKQR 535 S +D+++ N+F FG + + R P ++R Sbjct: 328 SSFTDEDVSNYFGNFGPVQDVRIPYQQKR 356 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 27.9 bits (59), Expect = 8.3 Identities = 22/102 (21%), Positives = 44/102 (43%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 421 F + ++ + V D +T +SRG AF+++ + E K + + I N + A + Sbjct: 77 FSTFGKVARVTVLKDRHTRQSRGVAFVLYVSREDAAKAARSMDAKILNGRKLTVSIAADN 136 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 G+ + + D+ R + L + CP + +ER Sbjct: 137 GRA-SEFIKKRVYKDKSRCYECGDEGHLSYECPKNQLGPRER 177 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,880,992 Number of Sequences: 28952 Number of extensions: 334854 Number of successful extensions: 1691 Number of sequences better than 10.0: 148 Number of HSP's better than 10.0 without gapping: 1218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1669 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1814318400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -